Property Summary

NCBI Gene PubMed Count 17
PubMed Score 9.11
PubTator Score 6.22

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Azoospermia 110 3.157 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
active ulcerative colitis -1.090 4.0e-02
adult high grade glioma 1.200 3.4e-02
cystic fibrosis 1.071 8.6e-04
osteosarcoma -2.890 1.7e-07
pituitary cancer 2.100 1.3e-04
sonic hedgehog group medulloblastoma 1.100 2.2e-02

 MGI Phenotype (1)

Gene RIF (10)

AA Sequence

MATVIHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCYIWMEKRHRGPGLAPGQ      1 - 70
LYTYPARCWRKKRRLHPPEDPKLRLLEIKPEVELPLKKDGFTSESTTLEALLRGEGVEKKVDAREEESIQ     71 - 140
EIQRVLENDENVEEGNEEEDLEEDIPKRKNRTRGRARGSAGGRRRHDAASQEDHDKPYVCDICGKRYKNR    141 - 210
PGLSYHYAHTHLASEEGDEAQDQETRSPPNHRNENHRPQKGPDGTVIPNNYCDFCLGGSNMNKKSGRPEE    211 - 280
LVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPV    281 - 350
AEPPEGSWSCHLCWELLKEKASAFGCQA                                              351 - 378
//

Text Mined References (20)

PMID Year Title