Property Summary

NCBI Gene PubMed Count 16
Grant Count 1
Funding $21,560
PubMed Score 7.20
PubTator Score 6.22

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -4.021 0.000
cystic fibrosis 1.071 0.001
active ulcerative colitis -1.090 0.040
adult high grade glioma 1.200 0.034
sonic hedgehog group medulloblastoma 1.200 0.023
pituitary cancer 2.100 0.000

Synonym

Accession Q92784 A8MSI3 B7Z276 F5H575 Q32UJ0 Q6P9E6 Q6ZT41 Q9H7Y5
Symbols CERD4
BAF45C

Gene

 Grant Application (1)

PDB

2KWN   2KWO   5I3L   2KWJ   2KWK  

Gene RIF (9)

PMID Text
26582913 Activation of DPF3a upon hypertrophic stimuli in cardiac hypertrophy switches cardiac fetal gene expression from being silenced by HEY to being activated by BRG1.
25120773 Immunohistochemical staining showed that intensive DPF3 staining occurred in proximal anastomosis and the positive staining was hardly observed in stenotic segment in colon specimens from patients with Hirschsprung's disease
24271036 DFP3 protein rs10129954 SNP is associated with poor sperm morphology.
24155890 These findings provide insights in the STAT5 dependent transcriptional regulation of Dpf3.
22334708 by linking RelA and p50 to the SWI/SNF complex, DPF3a/b induces the transactivation of NF-kappaB target gene promoters in relatively inactive chromatin contexts.
20613843 three-dimensional solution structures and biochemical analysis of DPF3b highlight the molecular basis of the integrated tandem PHD finger, which acts as one functional unit in the sequence-specific recognition of lysine-14-acetylated histone H3
18978678 Observational study of gene-disease association. (HuGE Navigator)
18765789 DPF3 adds a further layer of complexity to the BAF complex by representing a tissue-specific anchor between histone acetylations as well as methylations and chromatin remodeling.
16109180 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MATVIHNPLKALGDQFYKEAIEHCRSYNSRLCAERSVRLPFLDSQTGVAQNNCYIWMEKRHRGPGLAPGQ      1 - 70
LYTYPARCWRKKRRLHPPEDPKLRLLEIKPEVELPLKKDGFTSESTTLEALLRGEGVEKKVDAREEESIQ     71 - 140
EIQRVLENDENVEEGNEEEDLEEDIPKRKNRTRGRARGSAGGRRRHDAASQEDHDKPYVCDICGKRYKNR    141 - 210
PGLSYHYAHTHLASEEGDEAQDQETRSPPNHRNENHRPQKGPDGTVIPNNYCDFCLGGSNMNKKSGRPEE    211 - 280
LVSCADCGRSGHPTCLQFTLNMTEAVKTYKWQCIECKSCILCGTSENDDQLLFCDDCDRGYHMYCLNPPV    281 - 350
AEPPEGSWSCHLCWELLKEKASAFGCQA                                              351 - 378
//

Text Mined References (18)

PMID Year Title
26582913 2016 Phosphorylation of the chromatin remodeling factor DPF3a induces cardiac hypertrophy through releasing HEY repressors from DNA.
25120773 2014 Expression profiles of HA117 and its neighboring gene DPF3 in different colon segments of Hirschsprung's disease.
24271036 2014 Variants in DPF3 and DSCAML1 are associated with sperm morphology.
24155890 2013 Identification of a STAT5 target gene, Dpf3, provides novel insights in chronic lymphocytic leukemia.
22334708 2012 Double plant homeodomain (PHD) finger proteins DPF3a and -3b are required as transcriptional co-activators in SWI/SNF complex-dependent activation of NF-?B RelA/p50 heterodimer.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
20613843 2010 Mechanism and regulation of acetylated histone binding by the tandem PHD finger of DPF3b.
18978678 2008 Candidate gene/loci studies in cleft lip/palate and dental anomalies finds novel susceptibility genes for clefts.
18765789 2008 Regulation of muscle development by DPF3, a novel histone acetylation and methylation reader of the BAF chromatin remodeling complex.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
More...