Property Summary

NCBI Gene PubMed Count 43
PubMed Score 12.87
PubTator Score 60.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.9

Expression

  Differential Expression (6)

Disease log2 FC p
acute quadriplegic myopathy 1.788 5.1e-06
Chronic Lymphocytic Leukemia 1.658 1.6e-04
juvenile dermatomyositis 1.286 4.7e-11
Multiple myeloma 1.411 2.6e-03
ovarian cancer -1.700 1.6e-06
psoriasis 1.600 5.1e-04

Protein-protein Interaction (5)

Gene RIF (14)

AA Sequence

MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLG      1 - 70
ACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGV     71 - 140
TFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH    141 - 210
EGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKK    211 - 280
TVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDI    281 - 350
DRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA    351 - 420
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVYSPPPAATAAA    421 - 490
ATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL                        491 - 540
//

Text Mined References (51)

PMID Year Title