Property Summary

NCBI Gene PubMed Count 39
Grant Count 9
R01 Count 9
Funding $459,030.93
PubMed Score 12.62
PubTator Score 60.58

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.658 0.000
Multiple myeloma 1.411 0.003
psoriasis 1.600 0.001
juvenile dermatomyositis 1.286 0.000
acute quadriplegic myopathy 1.788 0.000
ovarian cancer -1.700 0.000

 GO Function (1)

Gene RIF (13)

PMID Text
26601948 The VHS domain of STAM1 directs AMSH to cleave longer Lys63-linked ubiquitin chains
25884766 Differential expression of the transcripts STAM connects ubiquitin-proteasome system with infection-inflammation in preterm births and preterm premature rupture of membranes.
25296754 ESCRT-0 protein hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) is targeted to endosomes independently of signal-transducing adaptor molecule (STAM) and the complex formation with STAM promotes its endosomal dissociation.
22275353 Overexpression of an AIP4 catalytically inactive mutant and a mutant that shows poor binding to STAM-1 fails to enhance CXCR4-induced ERK-1/2 signaling.
19111546 A novel ubiquitin binding site and the manner of ubiquitin recognition of the STAM1 VHS domain were proposed.
19054391 STAMs function prominently in endoplasmic reticulum-to-Golgi trafficking, most likely through direct interactions with the coat protein II complex
16520378 The cellular functions of UBPY are complex but clearly distinct from those of the Lys-63-ubiquitin-specific protease, AMSH, with which it shares a binding site on the SH3 domain of STAM
16385451 Observational study of gene-disease association. (HuGE Navigator)
15828871 Analysis with phospho-specific antibodies indicates that 3 kinases generate a signal-specific, combinatorial phosphorylation profile of the Hrs-STAM complex, with the potential of diversifying tyrosine kinase receptor signalling through a common element.
15640163 Hrs is a master molecule that controls in part the degradation of STAM1 and the accumulation of ubiquitinated proteins
More...

AA Sequence

MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLG      1 - 70
ACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGV     71 - 140
TFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH    141 - 210
EGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKK    211 - 280
TVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDI    281 - 350
DRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA    351 - 420
QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVYSPPPAATAAA    421 - 490
ATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL                        491 - 540
//

Text Mined References (46)

PMID Year Title
26601948 2016 The Vps27/Hrs/STAM (VHS) Domain of the Signal-transducing Adaptor Molecule (STAM) Directs Associated Molecule with the SH3 Domain of STAM (AMSH) Specificity to Longer Ubiquitin Chains and Dictates the Position of Cleavage.
25884766 2015 Epigenetic regulation of lncRNA connects ubiquitin-proteasome system with infection-inflammation in preterm births and preterm premature rupture of membranes.
25296754 2014 ESCRT-0 protein hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) is targeted to endosomes independently of signal-transducing adaptor molecule (STAM) and the complex formation with STAM promotes its endosomal dissociation.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24105262 2013 Analysis of ESCRT functions in exosome biogenesis, composition and secretion highlights the heterogeneity of extracellular vesicles.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22275353 2012 Novel roles for the E3 ubiquitin ligase atrophin-interacting protein 4 and signal transduction adaptor molecule 1 in G protein-coupled receptor signaling.
21269460 2011 Initial characterization of the human central proteome.
21187078 2011 Solution structure of UIM and interaction of tandem ubiquitin binding domains in STAM1 with ubiquitin.
20927613 2011 Backbone 1H, 13C, and 15N assignments for the tandem ubiquitin binding domains of signal transducing adapter molecule 1.
More...