Tbio | Signal transducing adapter molecule 1 |
Involved in intracellular signal transduction mediated by cytokines and growth factors. Upon IL-2 and GM-CSL stimulation, it plays a role in signaling leading to DNA synthesis and MYC induction. May also play a role in T-cell development. Involved in down-regulation of receptor tyrosine kinase via multivesicular body (MVBs) when complexed with HGS (ESCRT-0 complex). The ESCRT-0 complex binds ubiquitin and acts as sorting machinery that recognizes ubiquitinated receptors and transfers them to further sequential lysosomal sorting/trafficking processes.
This gene encodes a member of the signal-transducing adaptor molecule family. These proteins mediate downstream signaling of cytokine receptors and also play a role in ER to Golgi trafficking by interacting with the coat protein II complex. The encoded protein also associates with hepatocyte growth factor-regulated substrate to form the endosomal sorting complex required for transport-0 (ESCRT-0), which sorts ubiquitinated membrane proteins to the ESCRT-1 complex for lysosomal degradation. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Feb 2011]
This gene encodes a member of the signal-transducing adaptor molecule family. These proteins mediate downstream signaling of cytokine receptors and also play a role in ER to Golgi trafficking by interacting with the coat protein II complex. The encoded protein also associates with hepatocyte growth factor-regulated substrate to form the endosomal sorting complex required for transport-0 (ESCRT-0), which sorts ubiquitinated membrane proteins to the ESCRT-1 complex for lysosomal degradation. Alternatively spliced transcript variants have been observed for this gene. [provided by RefSeq, Feb 2011]
Comments
Disease | Target Count | P-value |
---|---|---|
juvenile dermatomyositis | 1189 | 4.6507852849923E-11 |
ovarian cancer | 8492 | 1.63322942935508E-6 |
acute quadriplegic myopathy | 1157 | 5.12809214270719E-6 |
chronic lymphocytic leukemia | 244 | 1.57191635785828E-4 |
psoriasis | 6685 | 5.13450342862138E-4 |
Multiple myeloma | 1328 | 0.00259633416195713 |
Disease | log2 FC | p |
---|---|---|
chronic lymphocytic leukemia | 1.658 | 0.000 |
Multiple myeloma | 1.411 | 0.003 |
psoriasis | 1.600 | 0.001 |
juvenile dermatomyositis | 1.286 | 0.000 |
acute quadriplegic myopathy | 1.788 | 0.000 |
ovarian cancer | -1.700 | 0.000 |
Species | Source |
---|---|
Chimp | OMA Inparanoid |
Macaque | OMA Inparanoid |
Mouse | OMA Inparanoid |
Rat | OMA Inparanoid |
Dog | OMA Inparanoid |
Horse | OMA Inparanoid |
Cow | OMA Inparanoid |
Pig | OMA Inparanoid |
Opossum | OMA Inparanoid |
Platypus | OMA Inparanoid |
Anole lizard | OMA Inparanoid |
Xenopus | OMA Inparanoid |
Zebrafish | OMA Inparanoid |
S.cerevisiae | OMA Inparanoid |
PMID | Text |
---|---|
26601948 | The VHS domain of STAM1 directs AMSH to cleave longer Lys63-linked ubiquitin chains |
25884766 | Differential expression of the transcripts STAM connects ubiquitin-proteasome system with infection-inflammation in preterm births and preterm premature rupture of membranes. |
25296754 | ESCRT-0 protein hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) is targeted to endosomes independently of signal-transducing adaptor molecule (STAM) and the complex formation with STAM promotes its endosomal dissociation. |
22275353 | Overexpression of an AIP4 catalytically inactive mutant and a mutant that shows poor binding to STAM-1 fails to enhance CXCR4-induced ERK-1/2 signaling. |
19111546 | A novel ubiquitin binding site and the manner of ubiquitin recognition of the STAM1 VHS domain were proposed. |
19054391 | STAMs function prominently in endoplasmic reticulum-to-Golgi trafficking, most likely through direct interactions with the coat protein II complex |
16520378 | The cellular functions of UBPY are complex but clearly distinct from those of the Lys-63-ubiquitin-specific protease, AMSH, with which it shares a binding site on the SH3 domain of STAM |
16385451 | Observational study of gene-disease association. (HuGE Navigator) |
15828871 | Analysis with phospho-specific antibodies indicates that 3 kinases generate a signal-specific, combinatorial phosphorylation profile of the Hrs-STAM complex, with the potential of diversifying tyrosine kinase receptor signalling through a common element. |
15640163 | Hrs is a master molecule that controls in part the degradation of STAM1 and the accumulation of ubiquitinated proteins |
More... |
MPLFATNPFDQDVEKATSEMNTAEDWGLILDICDKVGQSRTGPKDCLRSIMRRVNHKDPHVAMQALTLLG 1 - 70 ACVSNCGKIFHLEVCSRDFASEVSNVLNKGHPKVCEKLKALMVEWTDEFKNDPQLSLISAMIKNLKEQGV 71 - 140 TFPAIGSQAAEQAKASPALVAKDPGTVANKKEEEDLAKAIELSLKEQRQQSTTLSTLYPSTSSLLTNHQH 141 - 210 EGRKVRAIYDFEAAEDNELTFKAGEIITVLDDSDPNWWKGETHQGIGLFPSNFVTADLTAEPEMIKTEKK 211 - 280 TVQFSDDVQVETIEPEPEPAFIDEDKMDQLLQMLQSTDPSDDQPDLPELLHLEAMCHQMGPLIDEKLEDI 281 - 350 DRKHSELSELNVKVMEALSLYTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNA 351 - 420 QMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQGNTYPSQAPVYSPPPAATAAA 421 - 490 ATADVTLYQNAGPNMPQVPNYNLTSSTLPQPGGSQQPPQPQQPYSQKALL 491 - 540 //
PMID | Year | Title |
---|---|---|
26601948 | 2016 | The Vps27/Hrs/STAM (VHS) Domain of the Signal-transducing Adaptor Molecule (STAM) Directs Associated Molecule with the SH3 Domain of STAM (AMSH) Specificity to Longer Ubiquitin Chains and Dictates the Position of Cleavage. |
25884766 | 2015 | Epigenetic regulation of lncRNA connects ubiquitin-proteasome system with infection-inflammation in preterm births and preterm premature rupture of membranes. |
25296754 | 2014 | ESCRT-0 protein hepatocyte growth factor-regulated tyrosine kinase substrate (Hrs) is targeted to endosomes independently of signal-transducing adaptor molecule (STAM) and the complex formation with STAM promotes its endosomal dissociation. |
24275569 | 2014 | An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. |
24105262 | 2013 | Analysis of ESCRT functions in exosome biogenesis, composition and secretion highlights the heterogeneity of extracellular vesicles. |
23186163 | 2013 | Toward a comprehensive characterization of a human cancer cell phosphoproteome. |
22275353 | 2012 | Novel roles for the E3 ubiquitin ligase atrophin-interacting protein 4 and signal transduction adaptor molecule 1 in G protein-coupled receptor signaling. |
21269460 | 2011 | Initial characterization of the human central proteome. |
21187078 | 2011 | Solution structure of UIM and interaction of tandem ubiquitin binding domains in STAM1 with ubiquitin. |
20927613 | 2011 | Backbone 1H, 13C, and 15N assignments for the tandem ubiquitin binding domains of signal transducing adapter molecule 1. |
More... |