Property Summary

NCBI Gene PubMed Count 3
PubMed Score 9.89
PubTator Score 6.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
ependymoma 4679 5.6e-11
osteosarcoma 7950 1.1e-03
group 3 medulloblastoma 4104 2.1e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6

Expression

  Differential Expression (3)

Disease log2 FC p
ependymoma -1.100 5.6e-11
group 3 medulloblastoma -1.200 2.1e-03
osteosarcoma 1.198 1.1e-03

AA Sequence

MGGLSARPTAGRTDPAGTCWGQDPGSKMATVIPGPLSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDS      1 - 70
QTGVAQNNCYIWMEKTHRGPGLAPGQIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPE     71 - 140
GPVLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQ    141 - 210
DTASLEDRDKPYVCDKFYKELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCG    211 - 280
RSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDGASWAGLTPQDQLLFCDDCDRGYHMYCLSP    281 - 350
PMAEPPEGSWSCHLCLRHLKEKASAYITLT                                            351 - 380
//

Text Mined References (8)

PMID Year Title