Property Summary

NCBI Gene PubMed Count 3
PubMed Score 8.54
PubTator Score 6.03

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
ependymoma 2514 5.64877981100864E-11
osteosarcoma 7933 0.0010663379725341
group 3 medulloblastoma 2254 0.00250279005205114
Disease Target Count Z-score Confidence
spina bifida 1064 3.061 1.5

Expression

  Differential Expression (3)

Disease log2 FC p
osteosarcoma 1.198 0.001
ependymoma -1.100 0.000
group 3 medulloblastoma -1.500 0.003

Synonym

Accession Q92782 B3KSY8 Q08AJ0
Symbols NEUD4
BAF45b
neuro-d4

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Pathway (1)

AA Sequence

MGGLSARPTAGRTDPAGTCWGQDPGSKMATVIPGPLSLGEDFYREAIEHCRSYNARLCAERSLRLPFLDS      1 - 70
QTGVAQNNCYIWMEKTHRGPGLAPGQIYTYPARCWRKKRRLNILEDPRLRPCEYKIDCEAPLKKEGGLPE     71 - 140
GPVLEALLCAETGEKKIELKEEETIMDCQKQQLLEFPHDLEVEDLEDDIPRRKNRAKGKAYGIGGLRKRQ    141 - 210
DTASLEDRDKPYVCDKFYKELAWVPEAQRKHTAKKAPDGTVIPNGYCDFCLGGSKKTGCPEDLISCADCG    211 - 280
RSGHPSCLQFTVNMTAAVRTYRWQCIECKSCSLCGTSENDGASWAGLTPQDQLLFCDDCDRGYHMYCLSP    281 - 350
PMAEPPEGSWSCHLCLRHLKEKASAYITLT                                            351 - 380
//

Text Mined References (6)

PMID Year Title
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15057824 2004 The DNA sequence and biology of human chromosome 19.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
8812431 1996 The d4 gene family in the human genome.