Property Summary

NCBI Gene PubMed Count 40
PubMed Score 0.00
PubTator Score 89.03

Knowledge Summary

Patent

No data available

Gene RIF (17)

PMID Text
25088614 Both GABRA6 and Synapsin II polymorphisms are important risk factors for the development of idiopathic generalized epilepsy in a South Indian population.
23956174 Results identify SYN2 as a novel predisposing gene for autism spectrum disorders (ASD) and strengthen the hypothesis that a disturbance of synaptic homeostasis underlies ASD.
22384280 Synapsin II is involved in the molecular pathway of lithium treatment in bipolar disorder
21465568 SYN2 rs3773364 A>G polymorphism is not a risk factor for susceptibility to epilepsy in this case-control study and meta-analysis.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20034013 Results from our study indicate the involvement of SYN2 gene polymorphism in conferring risk to epilepsy; however, the genetic variant does not seem to modulate drug-response in epilepsy pharmacotherapy.
20034013 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
19665806 A case-control study with synapsin II was conducted in 506 bipolar disorder patients and 507 healthy individuals from the Han Chinese population. No association was found in this study.
More...

AA Sequence

MMNFLRRRLSDSSFIANLPNGYMTDLQRPEPQQAPTPPPPGPGAASASAAPPTASPGPERTPPAASAPAP      1 - 70
PPARTPSVGSSLFSSLSQAVKQTAASAGLVDAPGAAPAAARKAKVLLVVDEPHADWAKCFRGKKVLGDYD     71 - 140
IKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLIIGMQYAGL    141 - 210
PSINSLESIYNFCDKPWVFAQLVAIYKTLGGEKFPLIEQTYYPNHKEMLTLPTFPVVVKIGHAHSGMGKV    211 - 280
KVENHYDFQDIASVVALTQTYATAEPFIDSKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMS    281 - 350
DRYKLWVDTCSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITELVISKMNQLLSR    351 - 420
TPALSPQRPLTTQQPQSGTLKDPDSSKTPPQRPPPQGGPGQPQGMQPPGKVLPPRRLPPGPSLPPSSSSS    421 - 490
SSSSSSAPQRPGGPTTHGDAPSSSSSLAEAQPPLAAPPQKPQPHPQLNKSQSLTNAFSFSESSFFRSSAN    491 - 560
EDEAKAETIRSLRKSFASLFSD                                                    561 - 582
//

Text Mined References (41)

PMID Year Title
25088614 2014 Association of GABRA6 1519 T>C (rs3219151) and Synapsin II (rs37733634) gene polymorphisms with the development of idiopathic generalized epilepsy.
23956174 2014 SYN2 is an autism predisposing gene: loss-of-function mutations alter synaptic vesicle cycling and axon outgrowth.
23896626 2013 Identification of novel DNA-methylated genes that correlate with human prostate cancer and high-grade prostatic intraepithelial neoplasia.
23806299 2013 New methods for inducing the differentiation of amniotic-derived mesenchymal stem cells into motor neuron precursor cells.
23492904 2013 A novel human endogenous retroviral protein inhibits cell-cell fusion.
23443540 2013 Synapsin II desynchronizes neurotransmitter release at inhibitory synapses by interacting with presynaptic calcium channels.
22581228 2012 A genome-wide approach accounting for body mass index identifies genetic variants influencing fasting glycemic traits and insulin resistance.
22571925 2013 H3K4 tri-methylation in synapsin genes leads to different expression patterns in bipolar disorder and major depression.
22384280 2012 Synapsin II is involved in the molecular pathway of lithium treatment in bipolar disorder.
22139419 2011 New gene functions in megakaryopoiesis and platelet formation.
More...