Property Summary

NCBI Gene PubMed Count 41
PubMed Score 0.00
PubTator Score 89.03

Knowledge Summary

Patent

No data available

Gene RIF (18)

AA Sequence

MMNFLRRRLSDSSFIANLPNGYMTDLQRPEPQQAPTPPPPGPGAASASAAPPTASPGPERTPPAASAPAP      1 - 70
PPARTPSVGSSLFSSLSQAVKQTAASAGLVDAPGAAPAAARKAKVLLVVDEPHADWAKCFRGKKVLGDYD     71 - 140
IKVEQAEFSELNLVAHADGTYAVDMQVLRNGTKVVRSFRPDFVLIRQHAFGMAENEDFRHLIIGMQYAGL    141 - 210
PSINSLESIYNFCDKPWVFAQLVAIYKTLGGEKFPLIEQTYYPNHKEMLTLPTFPVVVKIGHAHSGMGKV    211 - 280
KVENHYDFQDIASVVALTQTYATAEPFIDSKYDIRVQKIGNNYKAYMRTSISGNWKTNTGSAMLEQIAMS    281 - 350
DRYKLWVDTCSEMFGGLDICAVKAVHGKDGKDYIFEVMDCSMPLIGEHQVEDRQLITELVISKMNQLLSR    351 - 420
TPALSPQRPLTTQQPQSGTLKDPDSSKTPPQRPPPQGGPGQPQGMQPPGKVLPPRRLPPGPSLPPSSSSS    421 - 490
SSSSSSAPQRPGGPTTHGDAPSSSSSLAEAQPPLAAPPQKPQPHPQLNKSQSLTNAFSFSESSFFRSSAN    491 - 560
EDEAKAETIRSLRKSFASLFSD                                                    561 - 582
//

Text Mined References (42)

PMID Year Title