Property Summary

Ligand Count 1
NCBI Gene PubMed Count 11
PubMed Score 16.31
PubTator Score 103.92

Knowledge Summary

Patent (17,200)

TINX Plot

  Disease (5)

Disease Target Count
Neoplastic Cell Transformation 89
Disease Target Count P-value
psoriasis 6694 3.9e-32
ovarian cancer 8520 5.3e-09
lung carcinoma 2843 1.7e-08
lung cancer 4740 1.0e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Meckel syndrome 46 3.339 1.7

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer -1.900 1.0e-04
lung carcinoma -1.100 1.7e-08
ovarian cancer 1.300 5.3e-09
psoriasis -2.300 3.9e-32

Gene RIF (2)

AA Sequence

MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNLLEVC      1 - 70
KKKKRWYLVFEFVDHTILDDLELFPNGLDYQVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVV     71 - 140
KLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDVWAIGCLVTEMFMGEPLFPGDSDIDQ    141 - 210
LYHIMMCLGNLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAE    211 - 280
LLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPKIKD    281 - 350
YKLFKIKGSKIDGEKAEKGNRASNASCLHDSRTSHNKIVPSTSLKDCSNVSVDHTRNPSVAIPPLTHNLS    351 - 420
AVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQME    421 - 490
HQH                                                                       491 - 493
//

Text Mined References (13)

PMID Year Title