Property Summary

NCBI Gene PubMed Count 11
PubMed Score 13.48
PubTator Score 103.92

Knowledge Summary

Patent (17,200)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
psoriasis 6685 3.8841994201046E-32
ovarian cancer 8492 5.27027644902517E-9
lung carcinoma 2844 1.70608201724525E-8
lung cancer 4473 1.03058602406479E-4
Disease Target Count Z-score Confidence
Meckel syndrome 48 3.524 1.8
Joubert syndrome 62 3.205 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer -1.900 0.000
lung carcinoma -1.100 0.000
ovarian cancer 1.300 0.000
psoriasis -2.300 0.000

Synonym

Accession Q92772 B2R695
Symbols P56
KKIAMRE

Gene

PDB

4AAA   4BBM  

  Ortholog (11)

Species Source
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

 Collection (1)

 GWAS Trait (1)

Pathway (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (2)

PMID Text
25333262 High CDKL2 promotes epithelial-mesenchymal transition and breast cancer progression.
16631599 We hypothesized that LA might induce dissociation of p56(Lck) from CD4, thus leading to its downmodulation.

AA Sequence

MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNLLEVC      1 - 70
KKKKRWYLVFEFVDHTILDDLELFPNGLDYQVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVV     71 - 140
KLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDVWAIGCLVTEMFMGEPLFPGDSDIDQ    141 - 210
LYHIMMCLGNLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAE    211 - 280
LLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPKIKD    281 - 350
YKLFKIKGSKIDGEKAEKGNRASNASCLHDSRTSHNKIVPSTSLKDCSNVSVDHTRNPSVAIPPLTHNLS    351 - 420
AVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQME    421 - 490
HQH                                                                       491 - 493
//

Text Mined References (13)

PMID Year Title
25333262 2014 CDKL2 promotes epithelial-mesenchymal transition and breast cancer progression.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16631599 2006 Lipoic acid downmodulates CD4 from human T lymphocytes by dissociation of p56(Lck).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15499549 2004 Mutations in the X-linked cyclin-dependent kinase-like 5 (CDKL5/STK9) gene are associated with severe neurodevelopmental retardation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...