Property Summary

NCBI Gene PubMed Count 11
Grant Count 1
Funding $223,770.5
PubMed Score 13.48
PubTator Score 103.92

Knowledge Summary

Patent (17,200)

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer -1.900 0.000
lung carcinoma -1.100 0.000
ovarian cancer 1.300 0.000
psoriasis -2.300 0.000

Synonym

Accession Q92772 B2R695
Symbols P56
KKIAMRE

Gene

 Grant Application (1)

PDB

4AAA   4BBM  

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (2)

PMID Text
25333262 High CDKL2 promotes epithelial-mesenchymal transition and breast cancer progression.
16631599 We hypothesized that LA might induce dissociation of p56(Lck) from CD4, thus leading to its downmodulation.

AA Sequence

MEKYENLGLVGEGSYGMVMKCRNKDTGRIVAIKKFLESDDDKMVKKIAMREIKLLKQLRHENLVNLLEVC      1 - 70
KKKKRWYLVFEFVDHTILDDLELFPNGLDYQVVQKYLFQIINGIGFCHSHNIIHRDIKPENILVSQSGVV     71 - 140
KLCDFGFARTLAAPGEVYTDYVATRWYRAPELLVGDVKYGKAVDVWAIGCLVTEMFMGEPLFPGDSDIDQ    141 - 210
LYHIMMCLGNLIPRHQELFNKNPVFAGVRLPEIKEREPLERRYPKLSEVVIDLAKKCLHIDPDKRPFCAE    211 - 280
LLHHDFFQMDGFAERFSQELQLKVQKDARNVSLSKKSQNRKKEKEKDDSLVEERKTLVVQDTNADPKIKD    281 - 350
YKLFKIKGSKIDGEKAEKGNRASNASCLHDSRTSHNKIVPSTSLKDCSNVSVDHTRNPSVAIPPLTHNLS    351 - 420
AVAPSINSGMGTETIPIQGYRVDEKTKKCSIPFVKPNRHSPSGIYNINVTTLVSGPPLSDDSGADLPQME    421 - 490
HQH                                                                       491 - 493
//

Text Mined References (13)

PMID Year Title
25333262 2014 CDKL2 promotes epithelial-mesenchymal transition and breast cancer progression.
24270810 2013 High-content genome-wide RNAi screens identify regulators of parkin upstream of mitophagy.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17344846 2007 Patterns of somatic mutation in human cancer genomes.
16631599 2006 Lipoic acid downmodulates CD4 from human T lymphocytes by dissociation of p56(Lck).
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15499549 2004 Mutations in the X-linked cyclin-dependent kinase-like 5 (CDKL5/STK9) gene are associated with severe neurodevelopmental retardation.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...