Property Summary

NCBI Gene PubMed Count 4
PubMed Score 30.01
PubTator Score 1.00

Knowledge Summary

Patent

No data available

 GO Component (1)

AA Sequence

MRSGGGCSGSLSLRGPASFKFSGVCPDSRGLAFSVAILPAKKEDFMAELYRVLEAGKIGIFESPTGTGKS      1 - 70
LSLICGALSWLRDFEQKKREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKK     71 - 140
EERDLVNRLKAEQARRKQREERLQQLQHRVQLKYAAKRLRQEEEERENLLRLSREMLETGPEAERPEQLE    141 - 210
SGEEELVLAEYESDEEKKVASGVDEDEDDLEEEHITKIYHCSRTHSQLAQFVHEVKKSPFGKDVRLVSLG    211 - 280
SRQNLCVNEDVRSLGSVQLINNRCVDMQRSRHEKKKGAEEEKPKRRRQEKQAACPFYNHEQMGLLRDEAL    281 - 350
AEVKDMEQLLALGKEARACPYYGSRLAIPAAQLVVLPYQMLLHAATRQAAGIRLQDQVVIIDEAHNLIDT    351 - 420
TTSMHSVEVSGSQLCQAHSQLLQYMERYGKRLKAKNLMYLKQILYLLEKFVAVLGGNIKQNPNTQSLSQT    421 - 490
GMELKTINDFLFQSQIDNINLFKVQRYCEKSMISRKLFGFTERYGAVFSSREQPKLAGFQQFLQSLQPRT    491 - 560
TEALAAPADESQASVPQPASPLMHIEGFLAALTTANQDGRVILSRQGSLSQSTLKFLLLNPAVHFAQVVK    561 - 630
ECRAVVIAGGTMQPVSNFRQQLLACAGVEAERVVEFSCGHVIPPDNILPLVICSGVSNQPLEFTFQKRDL    631 - 700
PQMMDEVGRILCNLCGVVSGGVVCFFPSYEYLRQVHAHWEKGGLLGRLAARKKIFQEPKSAHQVEQVLLA    701 - 770
YSRCLQACGQERGPVTGALLLSVVGGKMSEGINFSDNLGRCVVMVGMPFPNIRSAELQEKMAYLDQTLPR    771 - 840
APGQAHPGKALVENLCMKAVNQSIGRAIRHQKDFASIVLLDQRYARPPVLAKLPAWIRARVEVKATFGPA    841 - 910
IAAVQKVSPTFFFLRASQPRDHISHCLLSAQFHREKSASS                                  911 - 950
//

Text Mined References (5)

PMID Year Title