Property Summary

NCBI Gene PubMed Count 4
PubMed Score 27.93
PubTator Score 1.00

Knowledge Summary

Patent

No data available

Synonym

Accession Q92771
Symbols CHLR2
DDX12

Gene

 GO Component (1)

AA Sequence

MRSGGGCSGSLSLRGPASFKFSGVCPDSRGLAFSVAILPAKKEDFMAELYRVLEAGKIGIFESPTGTGKS      1 - 70
LSLICGALSWLRDFEQKKREEEARLLETGTGPLHDEKDESLCLSSSCEGAAGTPRPAGEPAWVTQFVQKK     71 - 140
EERDLVNRLKAEQARRKQREERLQQLQHRVQLKYAAKRLRQEEEERENLLRLSREMLETGPEAERPEQLE    141 - 210
SGEEELVLAEYESDEEKKVASGVDEDEDDLEEEHITKIYHCSRTHSQLAQFVHEVKKSPFGKDVRLVSLG    211 - 280
SRQNLCVNEDVRSLGSVQLINNRCVDMQRSRHEKKKGAEEEKPKRRRQEKQAACPFYNHEQMGLLRDEAL    281 - 350
AEVKDMEQLLALGKEARACPYYGSRLAIPAAQLVVLPYQMLLHAATRQAAGIRLQDQVVIIDEAHNLIDT    351 - 420
TTSMHSVEVSGSQLCQAHSQLLQYMERYGKRLKAKNLMYLKQILYLLEKFVAVLGGNIKQNPNTQSLSQT    421 - 490
GMELKTINDFLFQSQIDNINLFKVQRYCEKSMISRKLFGFTERYGAVFSSREQPKLAGFQQFLQSLQPRT    491 - 560
TEALAAPADESQASVPQPASPLMHIEGFLAALTTANQDGRVILSRQGSLSQSTLKFLLLNPAVHFAQVVK    561 - 630
ECRAVVIAGGTMQPVSNFRQQLLACAGVEAERVVEFSCGHVIPPDNILPLVICSGVSNQPLEFTFQKRDL    631 - 700
PQMMDEVGRILCNLCGVVSGGVVCFFPSYEYLRQVHAHWEKGGLLGRLAARKKIFQEPKSAHQVEQVLLA    701 - 770
YSRCLQACGQERGPVTGALLLSVVGGKMSEGINFSDNLGRCVVMVGMPFPNIRSAELQEKMAYLDQTLPR    771 - 840
APGQAHPGKALVENLCMKAVNQSIGRAIRHQKDFASIVLLDQRYARPPVLAKLPAWIRARVEVKATFGPA    841 - 910
IAAVQKVSPTFFFLRASQPRDHISHCLLSAQFHREKSASS                                  911 - 950
//

Text Mined References (5)

PMID Year Title
16541075 2006 The finished DNA sequence of human chromosome 12.
15252450 2004 Lineage-specific gene duplication and loss in human and great ape evolution.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9013641 1997 Characterization of putative human homologues of the yeast chromosome transmission fidelity gene, CHL1.
8833153 1996 Localization of chi1-related helicase genes to human chromosome regions 12p11 and 12p13: similarity between parts of these genes and conserved human telomeric-associated DNA.