Property Summary

Ligand Count 626
NCBI Gene PubMed Count 310
PubMed Score 587.85
PubTator Score 373.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 3 medulloblastoma 1.700 2.2e-05
lung cancer 1.200 2.3e-03
medulloblastoma, large-cell 1.600 4.6e-05
ovarian cancer 2.200 3.6e-06
primitive neuroectodermal tumor 1.400 2.2e-04

Protein-protein Interaction (3)

Gene RIF (187)

AA Sequence

MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHS      1 - 70
DEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGL     71 - 140
HHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG    141 - 210
DLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVK    211 - 280
GHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSN    281 - 350
MTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE    351 - 420
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP      421 - 488
//

Text Mined References (332)

PMID Year Title