Property Summary

NCBI Gene PubMed Count 288
Grant Count 297
R01 Count 216
Funding $41,515,732.79
PubMed Score 528.78
PubTator Score 373.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
sonic hedgehog group medulloblastoma 1.900 0.000
medulloblastoma, large-cell 1.600 0.000
primitive neuroectodermal tumor 1.400 0.000
lung cancer 1.700 0.000
ovarian cancer 2.200 0.000

Synonym

Accession Q92769 B3KRS5 B4DL58 E1P561 Q5SRI8 Q5SZ86 Q8NEH4 HD2
Symbols HD2
RPD3
YAF1

Gene

PANTHER Protein Class (2)

PDB

3MAX   4LXZ   4LY1   5IWG   5IX0  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
651926 confirmatory 0 / 0 / 1 ML327 E-Cadherin HDAC Spectrum Assay_HDAC2

Gene RIF (166)

PMID Text
26846508 our study revealed that HDAC2 is overexpressed in colorectal cancer (CRC) cells; its knockdown can increase the sensitivity of CRC cells to doxorubicin via upregulation of ABCB1
26815200 Endothelial-Mesenchymal Transition is initiated by recruitment of aberrantly phosphorylated DNMT1 to the RASAL1 CpG island promoter by HDAC2, causing aberrant promoter methylation and transcriptional suppression.
26683361 Decreased HDAC2 expression is associated with cisplatin resistance in ovarian cancer.
26617781 In cigarette smoke extract-exposed airway epithelial cells and macrophages, HDAC2 is excessively ubiquitinated and degraded in the proteasome attributed to low expression of USP17.
26502922 Pancreatic adenocarcinoma patients with enhanced HDAC-1 and -6 expression showed significantly longer survival times compared to those with low expression, while a borderline association concerning HDAC-2 expression was noted.
26498345 Lymphocyte senescence in COPD is associated with loss of HDAC2 in CD28nullCD8+ T and NKT-like cells.
26359372 Aberrant overexpression of HDACs in basal cells of IPF lungs may contribute to the bronchiolisation process in this disease. Similarly, generation and apoptosis resistance of IPF fibroblasts are mediated by enhanced activity of HDAC enzymes.
26255936 simultaneous depletion of HDAC1/2 compromises the deacetylation of H3K56Ac, while depletion of HDAC1 or HDAC2 alone has no effect on H3K56Ac.
26116233 Results show that mRNA expression of histone deacetylases HDAC1 and HDAC2 were significantly increased in peripheral blood mononuclear cells of patients with with Graves' disease compared to controls.
26063464 HDAC2 may not confer susceptibility to Schizophrenia in Han Chinese.
More...

AA Sequence

MAYSQGGGKKKVCYYYDGDIGNYYYGQGHPMKPHRIRMTHNLLLNYGLYRKMEIYRPHKATAEEMTKYHS      1 - 70
DEYIKFLRSIRPDNMSEYSKQMQRFNVGEDCPVFDGLFEFCQLSTGGSVAGAVKLNRQQTDMAVNWAGGL     71 - 140
HHAKKSEASGFCYVNDIVLAILELLKYHQRVLYIDIDIHHGDGVEEAFYTTDRVMTVSFHKYGEYFPGTG    141 - 210
DLRDIGAGKGKYYAVNFPMRDGIDDESYGQIFKPIISKVMEMYQPSAVVLQCGADSLSGDRLGCFNLTVK    211 - 280
GHAKCVEVVKTFNLPLLMLGGGGYTIRNVARCWTYETAVALDCEIPNELPYNDYFEYFGPDFKLHISPSN    281 - 350
MTNQNTPEYMEKIKQRLFENLRMLPHAPGVQMQAIPEDAVHEDSGDEDGEDPDKRISIRASDKRIACDEE    351 - 420
FSDSEDEGEGGRRNVADHKKGAKKARIEEDKKETEDKKTDVKEEDKSKDNSGEKTDTKGTKSEQLSNP      421 - 488
//

Text Mined References (309)

PMID Year Title
26846508 2016 Histone deacetylase 2 regulates doxorubicin (Dox) sensitivity of colorectal cancer cells by targeting ABCB1 transcription.
26815200 2016 DNMT1 and HDAC2 Cooperate to Facilitate Aberrant Promoter Methylation in Inorganic Phosphate-Induced Endothelial-Mesenchymal Transition.
26683361 2016 The role of HDAC2 in chromatin remodelling and response to chemotherapy in ovarian cancer.
26617781 2015 USP17-mediated deubiquitination and stabilization of HDAC2 in cigarette smoke extract-induced inflammation.
26502922 2015 Histone deacetylase (HDAC)-1, -2, -4 and -6 expression in human pancreatic adenocarcinoma: associations with clinicopathological parameters, tumor proliferative capacity and patients' survival.
26498345 2015 Lymphocyte senescence in COPD is associated with decreased histone deacetylase 2 expression by pro-inflammatory lymphocytes.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26359372 2015 Aberrant expression and activity of histone deacetylases in sporadic idiopathic pulmonary fibrosis.
26255936 2015 Damaged DNA-binding protein down-regulates epigenetic mark H3K56Ac through histone deacetylase 1 and 2.
26116233 2015 Histone hypoacetylation and increased histone deacetylases in peripheral blood mononuclear cells from patients with Graves' disease.
More...