Property Summary

NCBI Gene PubMed Count 56
PubMed Score 284.54
PubTator Score 272.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Disease Target Count
Degenerative polyarthritis 93
Disease Target Count P-value
breast carcinoma 1614 5.17948246953211E-23
Breast cancer 3099 3.68445713975674E-11
lung carcinoma 2844 1.12703376239066E-10
posterior fossa group A ependymoma 1511 5.62169564206194E-7
non-small cell lung cancer 2798 1.57331871584802E-6
Duchenne muscular dystrophy 602 4.90679853816672E-6
lung cancer 4473 9.14824345299454E-5
psoriasis 6685 6.2881925157456E-4
pancreatic cancer 2300 0.00117229649647295
limb girdle muscular dystrophy 2B 74 0.00158498410735038
Amyotrophic Lateral Sclerosis 432 0.00162088101235715
interstitial cystitis 2299 0.00169312033095207
pilocytic astrocytoma 3086 0.00249066892947755
primary pancreatic ductal adenocarcinoma 1271 0.00284084490714893
osteosarcoma 7933 0.00302475932729679
ovarian cancer 8492 0.00439495930561021
nephrosclerosis 329 0.00476086775332173
non diabetic and post-ischemic heart failure 200 0.00477693914024967
urothelial carcinoma 318 0.00513311857885906
active Crohn's disease 918 0.00663364047518914
astrocytic glioma 2241 0.00980370681791461
Becker muscular dystrophy 187 0.0110895200901065
sonic hedgehog group medulloblastoma 1482 0.0114482610123639
type II diabetes mellitus and post-ischemic heart failure 89 0.0117478543402274
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0156532010110131
medulloblastoma, large-cell 6234 0.015819380284996
primary Sjogren syndrome 789 0.0175800229829528
Pick disease 1893 0.0299871017218432
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0335853808247125
cutaneous lupus erythematosus 1056 0.0418638671724319
Disease Target Count
OSTEOARTHRITIS SUSCEPTIBILITY 1 1
Disease Target Count
Osteoarthritis 1 1

Expression

Synonym

Accession Q92765 O00181 Q99686 sFRP-3
Symbols FRE
OS1
FZRB
hFIZ
FRITZ
FRP-3
FRZB1
SFRP3
SRFP3
FRZB-1
FRZB-PEN

Gene

  Ortholog (14)

Gene RIF (46)

PMID Text
26722540 FRZB expression was up-regulated in hepatocellular carcinoma bone metastasis tissue, which suggested that FRZB might play a key role in the HCC bone metastasis.
26288364 Intermediate SFRP3 levels are associated with better survival and fewer cardiovascular events than low or high SFRP3 levels, independently of conventional risk factors, in older patients with chronic systolic Heart Failure of ischemic origin.
26097596 Positive expression of FRZB was statistically significantly associated with poor prognosis of patients with colon carcinoma hepatic metastasis.
26071485 Secreted Frizzled-Related Protein 3 (SFRP3) Is Required for Tumorigenesis of PAX3-FOXO1-Positive Alveolar Rhabdomyosarcoma
25920031 Intermediate levels of sFRP3 were a predictor of all-cause mortality and re-hospitalization in acute coronary syndromes.
25846075 Data suggest secreted FRP3 (frizzled related protein-3) interacts with ADAM17 (A disintegrin/metalloprotease 17) substrate IL6R (interleukin-6 receptor) release; this interaction is down-regulated in osteoarthritis due to rare double variant in FRP3.
25046226 study indicates that increased expression of both SFRP1 and SFRP3 may contribute to the pathogenesis of IUGR placental dysfunction, whereas the loss of these proteins may be involved in the development of human trophoblastic tumors.
24948145 These data indicate an important role of methylation-induced gene silencing of the sFRP gene family in human GBM.
24676361 FRZB knockdown may upregulate the Wnt/betacatenin pathway and promote aggressiveness in gastric cancer.
24662300 Our results suggest that the sFRP3 c.970C>G and sFRP4 c.958C>A polymorphisms may be genetic factors associated with the prevalence of osteoporosis at the femoral neck in postmenopausal Korean women.
More...

AA Sequence

MVCGSPGGMLLLRAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIE      1 - 70
QFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELP     71 - 140
VYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKC    141 - 210
HDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKD    211 - 280
RLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN                             281 - 325
//

Text Mined References (57)

PMID Year Title
26722540 2015 FRZB up-regulated in hepatocellular carcinoma bone metastasis.
26288364 2015 Secreted Frizzled Related Protein 3 in Chronic Heart Failure: Analysis from the Controlled Rosuvastatin Multinational Trial in Heart Failure (CORONA).
26097596 2015 FRZB up-regulation is correlated with hepatic metastasis and poor prognosis in colon carcinoma patients with hepatic metastasis.
26071485 2015 Secreted Frizzled-Related Protein 3 (SFRP3) Is Required for Tumorigenesis of PAX3-FOXO1-Positive Alveolar Rhabdomyosarcoma.
25920031 2015 Secreted Frizzled-Related Protein 3 (sFRP3) in acute coronary syndromes.
25846075 2015 Secreted Frizzled-related protein 3 (sFRP3)-mediated suppression of interleukin-6 receptor release by A disintegrin and metalloprotease 17 (ADAM17) is abrogated in the osteoarthritis-associated rare double variant of sFRP3.
25046226 2014 Immunohistochemical expression of SFRP1 and SFRP3 proteins in normal and malignant reproductive tissues of rats and humans.
24948145 2014 Epigenetic regulation of the secreted frizzled-related protein family in human glioblastoma multiforme.
24676361 2014 FRZB knockdown upregulates ?-catenin activity and enhances cell aggressiveness in gastric cancer.
24662300 2014 Association between polymorphisms in sclerostin, dickkopfs and secreted frizzled-related protein genes and bone mineral density in postmenopausal Korean women.
More...