Property Summary

NCBI Gene PubMed Count 60
PubMed Score 308.38
PubTator Score 272.42

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Osteoarthritis 184 4.626 2.3
Disease Target Count
Degenerative polyarthritis 115
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count
OSTEOARTHRITIS SUSCEPTIBILITY 1 1

Expression

  Differential Expression (30)

Gene RIF (50)

AA Sequence

MVCGSPGGMLLLRAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIE      1 - 70
QFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELP     71 - 140
VYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKC    141 - 210
HDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKD    211 - 280
RLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN                             281 - 325
//

Text Mined References (61)

PMID Year Title