Property Summary

NCBI Gene PubMed Count 56
Grant Count 91
R01 Count 66
Funding $10,768,179.03
PubMed Score 284.54
PubTator Score 272.42

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92765 O00181 Q99686 sFRP-3
Symbols FRE
OS1
FZRB
hFIZ
FRITZ
FRP-3
FRZB1
SFRP3
SRFP3
FRZB-1
FRZB-PEN

Gene

Gene RIF (46)

PMID Text
26722540 FRZB expression was up-regulated in hepatocellular carcinoma bone metastasis tissue, which suggested that FRZB might play a key role in the HCC bone metastasis.
26288364 Intermediate SFRP3 levels are associated with better survival and fewer cardiovascular events than low or high SFRP3 levels, independently of conventional risk factors, in older patients with chronic systolic Heart Failure of ischemic origin.
26097596 Positive expression of FRZB was statistically significantly associated with poor prognosis of patients with colon carcinoma hepatic metastasis.
26071485 Secreted Frizzled-Related Protein 3 (SFRP3) Is Required for Tumorigenesis of PAX3-FOXO1-Positive Alveolar Rhabdomyosarcoma
25920031 Intermediate levels of sFRP3 were a predictor of all-cause mortality and re-hospitalization in acute coronary syndromes.
25846075 Data suggest secreted FRP3 (frizzled related protein-3) interacts with ADAM17 (A disintegrin/metalloprotease 17) substrate IL6R (interleukin-6 receptor) release; this interaction is down-regulated in osteoarthritis due to rare double variant in FRP3.
25046226 study indicates that increased expression of both SFRP1 and SFRP3 may contribute to the pathogenesis of IUGR placental dysfunction, whereas the loss of these proteins may be involved in the development of human trophoblastic tumors.
24948145 These data indicate an important role of methylation-induced gene silencing of the sFRP gene family in human GBM.
24676361 FRZB knockdown may upregulate the Wnt/betacatenin pathway and promote aggressiveness in gastric cancer.
24662300 Our results suggest that the sFRP3 c.970C>G and sFRP4 c.958C>A polymorphisms may be genetic factors associated with the prevalence of osteoporosis at the femoral neck in postmenopausal Korean women.
More...

AA Sequence

MVCGSPGGMLLLRAGLLALAALCLLRVPGARAAACEPVRIPLCKSLPWNMTKMPNHLHHSTQANAILAIE      1 - 70
QFEGLLGTHCSPDLLFFLCAMYAPICTIDFQHEPIKPCKSVCERARQGCEPILIKYRHSWPENLACEELP     71 - 140
VYDRGVCISPEAIVTADGADFPMDSSNGNCRGASSERCKCKPIRATQKTYFRNNYNYVIRAKVKEIKTKC    141 - 210
HDVTAVVEVKEILKSSLVNIPRDTVNLYTSSGCLCPPLNVNEEYIIMGYEDEERSRLLLVEGSIAEKWKD    211 - 280
RLGKKVKRWDMKLRHLGLSKSDSSNSDSTQSQKSGRNSNPRQARN                             281 - 325
//

Text Mined References (57)

PMID Year Title
26722540 2015 FRZB up-regulated in hepatocellular carcinoma bone metastasis.
26288364 2015 Secreted Frizzled Related Protein 3 in Chronic Heart Failure: Analysis from the Controlled Rosuvastatin Multinational Trial in Heart Failure (CORONA).
26097596 2015 FRZB up-regulation is correlated with hepatic metastasis and poor prognosis in colon carcinoma patients with hepatic metastasis.
26071485 2015 Secreted Frizzled-Related Protein 3 (SFRP3) Is Required for Tumorigenesis of PAX3-FOXO1-Positive Alveolar Rhabdomyosarcoma.
25920031 2015 Secreted Frizzled-Related Protein 3 (sFRP3) in acute coronary syndromes.
25846075 2015 Secreted Frizzled-related protein 3 (sFRP3)-mediated suppression of interleukin-6 receptor release by A disintegrin and metalloprotease 17 (ADAM17) is abrogated in the osteoarthritis-associated rare double variant of sFRP3.
25046226 2014 Immunohistochemical expression of SFRP1 and SFRP3 proteins in normal and malignant reproductive tissues of rats and humans.
24948145 2014 Epigenetic regulation of the secreted frizzled-related protein family in human glioblastoma multiforme.
24676361 2014 FRZB knockdown upregulates ?-catenin activity and enhances cell aggressiveness in gastric cancer.
24662300 2014 Association between polymorphisms in sclerostin, dickkopfs and secreted frizzled-related protein genes and bone mineral density in postmenopausal Korean women.
More...