Property Summary

NCBI Gene PubMed Count 10
Grant Count 6
Funding $254,397.34
PubMed Score 50.01
PubTator Score 31.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.200 0.002
psoriasis -1.300 0.041

Gene RIF (2)

PMID Text
18021261 p65 induces transcriptional activation of Ha5. It is co-expressed with it & may mediate the NF-kappaB pathway's activity. There are major NF-kappaB/RelA binding sites in its regulatory region; p65 binds directly to these sites.
15140206 the co-expression of hair keratin hHa5 with its regulatory nuclear homeoprotein HOXC13 in matrix cells of the hair follicle is maintained in lower transitional cells of pilomatricomas

AA Sequence

MASKCLKAGFSSGSLKSPGGASGGSTRVSAMYSSSSCKLPSLSPVARSFSACSVGLGRSSYRATSCLPAL      1 - 70
CLPAGGFATSYSGGGGWFGEGILTGNEKETMQSLNDRLAGYLEKVRQLEQENASLESRIREWCEQQVPYM     71 - 140
CPDYQSYFRTIEELQKKTLCSKAENARLVVEIDNAKLAADDFRTKYETEVSLRQLVESDINGLRRILDDL    141 - 210
TLCKSDLEAQVESLKEELLCLKKNHEEEVNSLRCQLGDRLNVEVDAAPPVDLNRVLEEMRCQYETLVENN    211 - 280
RRDAEDWLDTQSEELNQQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHSMRDALESTLAETEARYSS    281 - 350
QLAQMQCMITNVEAQLAEIRADLERQNQEYQVLLDVRARLECEINTYRGLLESEDSKLPCNPCAPDYSPS    351 - 420
KSCLPCLPAASCGPSAARTNCSPRPICVPCPGGRF                                       421 - 455
//

Text Mined References (11)

PMID Year Title
23580065 2013 Shotgun proteomics reveals specific modulated protein patterns in tears of patients with primary open angle glaucoma naïve to therapy.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
18021261 2008 Transcriptional activation of a subset of hair keratin genes by the NF-kappaB effector p65/RelA.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
16831889 2006 New consensus nomenclature for mammalian keratins.
16625196 2006 DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage.
15140206 2004 On the regulation of hair keratin expression: lessons from studies in pilomatricomas.
10391933 1999 The catalog of human hair keratins. I. Expression of the nine type I members in the hair follicle.
9756910 1998 Characterization of a 190-kilobase pair domain of human type I hair keratin genes.
8823373 1996 Genomic characterization of the human type I cuticular hair keratin hHa2 and identification of an adjacent novel type I hair keratin gene hHa5.
More...