Property Summary

NCBI Gene PubMed Count 10
PubMed Score 55.42
PubTator Score 31.68

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
diabetes mellitus 1728 1.9e-03
psoriasis 6694 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (2)

Disease log2 FC p
diabetes mellitus 1.200 1.9e-03
psoriasis -1.300 4.1e-02

Synonym

Accession Q92764 O76012 Q92651
Symbols HA5
Ha-5
hHa5
KRTHA5

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MASKCLKAGFSSGSLKSPGGASGGSTRVSAMYSSSSCKLPSLSPVARSFSACSVGLGRSSYRATSCLPAL      1 - 70
CLPAGGFATSYSGGGGWFGEGILTGNEKETMQSLNDRLAGYLEKVRQLEQENASLESRIREWCEQQVPYM     71 - 140
CPDYQSYFRTIEELQKKTLCSKAENARLVVEIDNAKLAADDFRTKYETEVSLRQLVESDINGLRRILDDL    141 - 210
TLCKSDLEAQVESLKEELLCLKKNHEEEVNSLRCQLGDRLNVEVDAAPPVDLNRVLEEMRCQYETLVENN    211 - 280
RRDAEDWLDTQSEELNQQVVSSSEQLQSCQAEIIELRRTVNALEIELQAQHSMRDALESTLAETEARYSS    281 - 350
QLAQMQCMITNVEAQLAEIRADLERQNQEYQVLLDVRARLECEINTYRGLLESEDSKLPCNPCAPDYSPS    351 - 420
KSCLPCLPAASCGPSAARTNCSPRPICVPCPGGRF                                       421 - 455
//

Text Mined References (11)

PMID Year Title