Property Summary

NCBI Gene PubMed Count 60
PubMed Score 18.65
PubTator Score 30.67

Knowledge Summary

Patent

No data available

Expression

Gene RIF (35)

PMID Text
23986795 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
22524621 GTF2H4 variants may not be associated with susceptibility to aspirin-exacerbated respiratory disease and obstructive symptoms in asthmatics.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20522537 A single nucleotide polymorphism variant within the general transcription factor IIH, polypeptide 4 gene, GTF2H4, on chromosome 6p21.33 was significantly associated with MS
20522537 Observational study of gene-disease association. (HuGE Navigator)
19945377 Study demonstrates that an essential initiation factor, TFB2, forms a network of interactions with DNA near the transcription start site and facilitates promoter melting but may not be essential for promoter recognition.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19681155 The frequency of congenital ichthyosis, collodion-baby type, was significantly higher in the TFIIH mutated group of trichothiodystrophy patients.
18676829 For 6-4 photoproducts, we show that TFIIH complexes carrying an NH(2)-terminal XPD mutated protein are also deficient in recruitment of NER proteins downstream of TFIIH
18614043 TFIIH changes subunit composition in response to DNA damage. The CAK is released from the core during nucleotide excision repair (NER).
18391197 TAF7 interacts with the transcription factors, TFIIH and P-TEFb, resulting in the inhibition of their Pol II CTD kinase activities
18354501 The specific binding of the C-terminal acidic domain (AC-D) of the human TFIIEalpha subunit to the pleckstrin homology domain (PH-D) of the human TFIIH p62 subunit is demonstrated.
17466626 mechanism in which the helicase activity of XPB is not used for the opening and repair of damaged DNA, which is instead only driven by its ATPase activity, in combination with the helicase activity of XPD
17466625 XPG forms a stable complex with TFIIH, which is active in transcription and nucleotide excision repair
17242193 Alterations of chromatin at the RNA polymerase II stall site, which depend on CSB and TFIIH at least, are necessary for the UV-induced translocation of CSA to the nuclear matrix.
16874302 We conclude that the recruitment and activation of TFIIH represents a rate-limiting step for the emergence of HIV from latency.
15601838 TFIIH uses an expanded proximal promoter to regulate c-myc expression
15533047 The second domain of TFIIH p62 subunit(residues 186-240) contains a region of high sequence conservation with an invariant tyrosine/phenylalanine motif which could play a key role as a protein-protein recognition module within TFIIH.
14569024 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
12590132 General transcription factor IIH protects promoters from PC4-mediated repression by relieving the topological constraint imposed by PC4 through the ERCC3 helicase activity rather than by reducing the repressive activity of PC4 via its phosphorylation.
10866664 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10438593 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10082552 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
10066804 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9765201 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9651670 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9570510 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9334327 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9311822 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9184228 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9121429 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
9054383 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
8934526 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
8849451 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
8628270 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter

AA Sequence

MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAA      1 - 70
VALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDK     71 - 140
HARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPA    141 - 210
QLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRR    211 - 280
YYPTRLAINLSSGVSGAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRES    281 - 350
VQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFEL    351 - 420
LLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS                                421 - 462
//

Text Mined References (62)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
23028341 2012 Genome-wide association study for serum complement C3 and C4 levels in healthy Chinese subjects.
22524621 2012 Lack of association between GTF2H4 genetic variants and AERD development and FEV1 decline by aspirin provocation.
20848476 2010 Genetic predictors of medically refractory ulcerative colitis.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
19945377 2009 TFB2 is a transient component of the catalytic site of the human mitochondrial RNA polymerase.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19681155 2009 New clinico-genetic classification of trichothiodystrophy.
18676829 2008 Defective transcription/repair factor IIH recruitment to specific UV lesions in trichothiodystrophy syndrome.
18614043 2008 Nucleotide excision repair driven by the dissociation of CAK from TFIIH.
18391197 2008 TFIID component TAF7 functionally interacts with both TFIIH and P-TEFb.
18354501 2008 Structural insight into the TFIIE-TFIIH interaction: TFIIE and p53 share the binding region on TFIIH.
17466626 2007 Distinct roles for the XPB/p52 and XPD/p44 subcomplexes of TFIIH in damaged DNA opening during nucleotide excision repair.
17466625 2007 XPG stabilizes TFIIH, allowing transactivation of nuclear receptors: implications for Cockayne syndrome in XP-G/CS patients.
17242193 2007 Functional TFIIH is required for UV-induced translocation of CSA to the nuclear matrix.
16874302 2006 Recruitment of TFIIH to the HIV LTR is a rate-limiting step in the emergence of HIV from latency.
16702430 2006 Rapid evolution of major histocompatibility complex class I genes in primates generates new disease alleles in humans via hitchhiking diversity.
16246722 2005 Recognition of RNA polymerase II and transcription bubbles by XPG, CSB, and TFIIH: insights for transcription-coupled repair and Cockayne Syndrome.
15601838 2005 TFIIH operates through an expanded proximal promoter to fine-tune c-myc expression.
15533047 2004 Domain architecture of the p62 subunit from the human transcription/repair factor TFIIH deduced by limited proteolysis and mass spectrometry analysis.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15220921 2004 A new, tenth subunit of TFIIH is responsible for the DNA repair syndrome trichothiodystrophy group A.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14574404 2003 The DNA sequence and analysis of human chromosome 6.
14569024 2003 The Tat/TAR-dependent phosphorylation of RNA polymerase II C-terminal domain stimulates cotranscriptional capping of HIV-1 mRNA.
12646563 2003 Rrn3 becomes inactivated in the process of ribosomal DNA transcription.
12590132 2003 Alleviation of PC4-mediated transcriptional repression by the ERCC3 helicase activity of general transcription factor TFIIH.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12393749 2002 Multiple interactions between RNA polymerase I, TIF-IA and TAF(I) subunits regulate preinitiation complex assembly at the ribosomal gene promoter.
11313499 2001 Structural basis of transcription: an RNA polymerase II elongation complex at 3.3 A resolution.
11113176 2001 Studies of nematode TFIIE function reveal a link between Ser-5 phosphorylation of RNA polymerase II and the transition from transcription initiation to elongation.
10866664 2000 Tat modifies the activity of CDK9 to phosphorylate serine 5 of the RNA polymerase II carboxyl-terminal domain during human immunodeficiency virus type 1 transcription.
10677310 2000 Fine localization of a major disease-susceptibility locus for diffuse panbronchiolitis.
10583946 1999 Quality control by DNA repair.
10438593 1999 Direct evidence that HIV-1 Tat stimulates RNA polymerase II carboxyl-terminal domain hyperphosphorylation during transcriptional elongation.
10214908 DNA damage recognition during nucleotide excision repair in mammalian cells.
10082552 1999 Tat activates human immunodeficiency virus type 1 transcriptional elongation independent of TFIIH kinase.
10066804 1999 Tat-associated kinase (P-TEFb): a component of transcription preinitiation and elongation complexes.
9852112 1998 Immunoaffinity purification and functional characterization of human transcription factor IIH and RNA polymerase II from clonal cell lines that conditionally express epitope-tagged subunits of the multiprotein complexes.
9790902 1998 Cloning and characterization of three human cDNAs encoding mRNA (guanine-7-)-methyltransferase, an mRNA cap methylase.
9765201 1998 The HIV-1 Tat cellular coactivator Tat-SF1 is a general transcription elongation factor.
9651670 1998 Transcriptional control: Tat cofactors and transcriptional elongation.
9582279 1998 Cloning and functional characterization of PTRF, a novel protein which induces dissociation of paused ternary transcription complexes.
9570510 1998 Tat, Tat-associated kinase, and transcription.
9512541 1998 Isolation and characterization of a human cDNA for mRNA 5'-capping enzyme.
9405375 1997 Three transitions in the RNA polymerase II transcription complex during initiation.
9334327 1997 The HIV transactivator TAT binds to the CDK-activating kinase and activates the phosphorylation of the carboxy-terminal domain of RNA polymerase II.
9311822 1997 A human primary T-lymphocyte-derived human immunodeficiency virus type 1 Tat-associated kinase phosphorylates the C-terminal domain of RNA polymerase II and induces CAK activity.
9184228 1997 Purification of a Tat-associated kinase reveals a TFIIH complex that modulates HIV-1 transcription.
9130708 1997 Substrate specificity of the cdk-activating kinase (CAK) is altered upon association with TFIIH.
9121429 1997 The human immunodeficiency virus transactivator Tat interacts with the RNA polymerase II holoenzyme.
9118947 1997 Cloning and characterization of p52, the fifth subunit of the core of the transcription/DNA repair factor TFIIH.
9054383 1997 Association of Tat with purified HIV-1 and HIV-2 transcription preinitiation complexes.
8946909 1996 The general transcription factors of RNA polymerase II.
8934526 1996 Enhanced processivity of RNA polymerase II triggered by Tat-induced phosphorylation of its carboxy-terminal domain.
8849451 1996 Tat-SF1: cofactor for stimulation of transcriptional elongation by HIV-1 Tat.
8692842 1996 Human cyclin-dependent kinase-activating kinase exists in three distinct complexes.
8628270 1996 Three functional classes of transcriptional activation domain.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.
2449431 1988 ATP activates transcription initiation from promoters by RNA polymerase II in a reversible step prior to RNA synthesis.
1939271 1991 Abortive initiation is increased only for the weakest members of a set of down mutants of the adenovirus 2 major late promoter.