Property Summary

NCBI Gene PubMed Count 60
PubMed Score 18.65
PubTator Score 30.67

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92759 B4DTJ5 Q76KU4
Symbols P52
TFB2
TFIIH

Gene

PANTHER Protein Class (1)

PDB

5IY6   5IY7   5IY8   5IY9   5IVW  

Gene RIF (46)

PMID Text
23986795 TFIIH synergizes with HIV-1 Tat to induce transcription elongation from the HIV-1 LTR promoter
22524621 GTF2H4 variants may not be associated with susceptibility to aspirin-exacerbated respiratory disease and obstructive symptoms in asthmatics.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20522537 A single nucleotide polymorphism variant within the general transcription factor IIH, polypeptide 4 gene, GTF2H4, on chromosome 6p21.33 was significantly associated with MS
20522537 Observational study of gene-disease association. (HuGE Navigator)
19945377 Study demonstrates that an essential initiation factor, TFB2, forms a network of interactions with DNA near the transcription start site and facilitates promoter melting but may not be essential for promoter recognition.
19851445 Observational study of gene-disease association. (HuGE Navigator)
19681155 The frequency of congenital ichthyosis, collodion-baby type, was significantly higher in the TFIIH mutated group of trichothiodystrophy patients.
18676829 For 6-4 photoproducts, we show that TFIIH complexes carrying an NH(2)-terminal XPD mutated protein are also deficient in recruitment of NER proteins downstream of TFIIH
18614043 TFIIH changes subunit composition in response to DNA damage. The CAK is released from the core during nucleotide excision repair (NER).
More...

AA Sequence

MESTPSRGLNRVHLQCRNLQEFLGGLSPGVLDRLYGHPATCLAVFRELPSLAKNWVMRMLFLEQPLPQAA      1 - 70
VALWVKKEFSKAQEESTGLLSGLRIWHTQLLPGGLQGLILNPIFRQNLRIALLGGGKAWSDDTSQLGPDK     71 - 140
HARDVPSLDKYAEERWEVVLHFMVGSPSAAVSQDLAQLLSQAGLMKSTEPGEPPCITSAGFQFLLLDTPA    141 - 210
QLWYFMLQYLQTAQSRGMDLVEILSFLFQLSFSTLGKDYSVEGMSDSLLNFLQHLREFGLVFQRKRKSRR    211 - 280
YYPTRLAINLSSGVSGAGGTVHQPGFIVVETNYRLYAYTESELQIALIALFSEMLYRFPNMVVAQVTRES    281 - 350
VQQAIASGITAQQIIHFLRTRAHPVMLKQTPVLPPTITDQIRLWELERDRLRFTEGVLYNQFLSQVDFEL    351 - 420
LLAHARELGVLVFENSAKRLMVVTPAGHSDVKRFWKRQKHSS                                421 - 462
//

Text Mined References (62)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
23028341 2012 Genome-wide association study for serum complement C3 and C4 levels in healthy Chinese subjects.
22524621 2012 Lack of association between GTF2H4 genetic variants and AERD development and FEV1 decline by aspirin provocation.
20848476 2010 Genetic predictors of medically refractory ulcerative colitis.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20522537 2010 Variation within DNA repair pathway genes and risk of multiple sclerosis.
19945377 2009 TFB2 is a transient component of the catalytic site of the human mitochondrial RNA polymerase.
19851445 2009 High-density SNP screening of the major histocompatibility complex in systemic lupus erythematosus demonstrates strong evidence for independent susceptibility regions.
19681155 2009 New clinico-genetic classification of trichothiodystrophy.
18676829 2008 Defective transcription/repair factor IIH recruitment to specific UV lesions in trichothiodystrophy syndrome.
More...