Property Summary

NCBI Gene PubMed Count 57
PubMed Score 69.76
PubTator Score 54.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Stomach Neoplasms 282
Disease Target Count P-value
non-small cell lung cancer 2798 7.04726764983101E-15
facioscapulohumeral dystrophy 286 9.20656583713201E-10
malignant mesothelioma 3163 2.53491677808921E-8
lung cancer 4473 4.70594620564458E-6
ulcerative colitis 2087 8.63277956056419E-6
psoriasis 6685 7.15938746445889E-5
non-inflammatory breast cancer 208 8.98749387064487E-5
ovarian cancer 8492 0.00127624114964216
colon cancer 1475 0.00341202761686876
active Crohn's disease 918 0.00802031648769495
interstitial cystitis 2299 0.0116045955489956
atypical teratoid / rhabdoid tumor 4369 0.0159553769786448
cutaneous lupus erythematosus 1056 0.022016891556843
Disease Target Count Z-score Confidence
Gonadoblastoma 27 4.017 2.0
Cancer 2346 3.725 1.9

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma 4.300 0.000
cutaneous lupus erythematosus -1.600 0.022
psoriasis -1.900 0.000
atypical teratoid / rhabdoid tumor 1.300 0.016
non-small cell lung cancer 1.596 0.000
colon cancer -2.900 0.003
lung cancer -4.800 0.000
active Crohn's disease 1.368 0.008
interstitial cystitis -1.400 0.012
non-inflammatory breast cancer -1.600 0.000
ulcerative colitis 1.500 0.000
ovarian cancer 1.800 0.001
facioscapulohumeral dystrophy 3.900 0.000

Synonym

Accession Q92754 B4DWK3 O00685 O00730 Q86V30 Q8IVB6 Q9P1X2 AP2-gamma
Symbols ERF1
TFAP2G
hAP-2g
AP2-GAMMA

Gene

PANTHER Protein Class (1)

  Ortholog (14)

Gene RIF (35)

PMID Text
26160249 Higher TFAP2C protein expression correlates with poor overall survival after 10 years of diagnosis in ERalpha-positive breast cancer.
25315380 In all three groups[preeclamptic placentas , healthy control and smokers] expression rates of AP-2gamma did not differ between primary, secondary and tertiary villi.
24969902 ShRNA knockdown of AP-2gamma in neuroblastoma cells results in significant inhibit of cell proliferation.
24469049 TFAP2C has an important role in regulated luminal-specific genes and may be a viable therapeutic target in breast cancer.
24045439 Knockdown of TFAP2C or RET inhibited activation of ERK and AKT in MCF-7 cells. Knockdown of TFAP2C, which controls ER (estrogen receptor) and RET, had a greater effect on cell growth than either RET or ER alone.
24023917 role for TFAP2C in melanoma via its regulation of ECM1
23334330 TFAP2C amplification and overexpression represents a genetic dependency in ERBB2+ve breast cancer.
23036739 ESDN and AP-2g expression is lower in thick melanomas, it is associated with unfavourable histo-pathological parameters (increased vascularity, vascular invasion and mitoses) and correlates with a shorter DFS like for AP-2a.
22964634 Results demonstrate that TFAP2C regulates the expression of GPX1, which influences the redox state and sensitivity to oxidative stress induced by peroxides.
22878616 TFAP2C regulates expression of the RET proto-oncogene through five AP-2 regulatory sites in the RET promoter.
More...

AA Sequence

MLWKITDNVKYEEDCEDRHDGSSNGNPRVPHLSSAGQHLYSPAPPLSHTGVAEYQPPPYFPPPYQQLAYS      1 - 70
QSADPYSHLGEAYAAAINPLHQPAPTGSQQQAWPGRQSQEGAGLPSHHGRPAGLLPHLSGLEAGAVSARR     71 - 140
DAYRRSDLLLPHAHALDAAGLAENLGLHDMPHQMDEVQNVDDQHLLLHDQTVIRKGPISMTKNPLNLPCQ    141 - 210
KELVGAVMNPTEVFCSVPGRLSLLSSTSKYKVTVAEVQRRLSPPECLNASLLGGVLRRAKSKNGGRSLRE    211 - 280
KLDKIGLNLPAGRRKAAHVTLLTSLVEGEAVHLARDFAYVCEAEFPSKPVAEYLTRPHLGGRNEMAARKN    281 - 350
MLLAAQQLCKEFTELLSQDRTPHGTSRLAPVLETNIQNCLSHFSLITHGFGSQAICAAVSALQNYIKEAL    351 - 420
IVIDKSYMNPGDQSPADSNKTLEKMEKHRK                                            421 - 450
//

Text Mined References (62)

PMID Year Title
26160249 2015 TFAP2C expression in breast cancer: correlation with overall survival beyond 10 years of initial diagnosis.
25315380 2015 Expression of AP-2? in placentas of patients with preeclampsia and of smokers.
24969902 2014 miR-200a inhibits tumor proliferation by targeting AP-2? in neuroblastoma cells.
24835590 2014 Sumoylation pathway is required to maintain the basal breast cancer subtype.
24621683 2014 Risk loci for chronic obstructive pulmonary disease: a genome-wide association study and meta-analysis.
24469049 2015 TFAP2C governs the luminal epithelial phenotype in mammary development and carcinogenesis.
24413532 2014 Differential regulation of estrogen receptor ? expression in breast cancer cells by metastasis-associated protein 1.
24045439 2014 Distinct pathways regulated by RET and estrogen receptor in luminal breast cancer demonstrate the biological basis for combination therapy.
24023917 2013 Human Melanoma cells over-express extracellular matrix 1 (ECM1) which is regulated by TFAP2C.
23334330 2014 Integrative molecular and functional profiling of ERBB2-amplified breast cancers identifies new genetic dependencies.
More...