Property Summary

Ligand Count 3
NCBI Gene PubMed Count 27
PubMed Score 70.92
PubTator Score 31.44

Knowledge Summary

Patent (2,086)

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -2.000 1.7e-02
astrocytic glioma -3.400 2.0e-03
Astrocytoma, Pilocytic -1.100 1.6e-04
atypical teratoid / rhabdoid tumor -3.400 1.0e-03
chronic rhinosinusitis -1.588 8.7e-03
ependymoma -3.000 1.8e-02
glioblastoma -2.300 2.7e-03
group 3 medulloblastoma -1.100 3.0e-02
interstitial cystitis -1.100 4.2e-03
medulloblastoma, large-cell -4.300 1.6e-03
nasopharyngeal carcinoma -1.200 6.8e-03
oligodendroglioma -2.700 1.3e-02
Pick disease 1.700 1.8e-02
primitive neuroectodermal tumor -3.000 2.6e-03

 GO Component (2)

Gene RIF (11)

AA Sequence

MCENQLKTKADATAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNR      1 - 70
NRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALARVYSSSISNG     71 - 140
LSNLNNETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFN    141 - 210
NGQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHA    211 - 280
IQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLV    281 - 350
NEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL    351 - 420
IAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK                        421 - 470
//

Text Mined References (28)

PMID Year Title