Property Summary

NCBI Gene PubMed Count 26
Grant Count 18
R01 Count 7
Funding $4,917,382.74
PubMed Score 66.42
PubTator Score 31.44

Knowledge Summary

Patent (2,086)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -3.400 0.002
ependymoma -3.000 0.018
oligodendroglioma -2.700 0.013
glioblastoma -2.300 0.003
group 3 medulloblastoma -4.800 0.000
atypical teratoid / rhabdoid tumor -3.400 0.001
medulloblastoma, large-cell -4.300 0.002
primitive neuroectodermal tumor -3.000 0.003
interstitial cystitis -1.100 0.004
adult high grade glioma -2.000 0.017
pilocytic astrocytoma -4.700 0.000
nasopharyngeal carcinoma -1.200 0.007
Pick disease 1.700 0.018
chronic rhinosinusitis -1.588 0.009

 GO Component (2)

Gene RIF (10)

PMID Text
25816151 Retinoic acid-related orphan receptor RORbeta, circadian rhythm abnormalities and tumorigenesis
25789810 associations between NR1D1, RORA and RORB genes and bipolar disorder.(
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of RAR-related orphan receptor B (RORB) in primary human brain microvascular endothelial cells
24125721 these data demonstrate that Rorbeta regulates known osteogenic pathways, and may represent a novel therapeutic target for age-associated bone loss.
23333304 Microarray analysis indicates HIV-1 Tat-induced upregulation of RAR-related orphan receptor B (RORB) in primary human brain microvascular endothelial cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19909500 Observational study of gene-disease association. (HuGE Navigator)
19839995 Observational study of gene-disease association. (HuGE Navigator)
11849752 In the suprachiasmatic nucleus, ROR beta mRNA signals showed a peak at early daytime and a trough at early nighttime. ROR beta is a transcription factor possibly related to the circadian pacemaking system.

AA Sequence

MCENQLKTKADATAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNR      1 - 70
NRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALARVYSSSISNG     71 - 140
LSNLNNETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFN    141 - 210
NGQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHA    211 - 280
IQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLV    281 - 350
NEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL    351 - 420
IAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK                        421 - 470
//

Text Mined References (27)

PMID Year Title
25816151 2015 Retinoic acid-related orphan receptor ROR?, circadian rhythm abnormalities and tumorigenesis (Review).
25789810 2015 Investigation of associations between NR1D1, RORA and RORB genes and bipolar disorder.
24125721 2013 Identification of Ror? targets in cultured osteoblasts and in human bone.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19909500 2009 Evidence for genetic association of RORB with bipolar disorder.
19839995 2009 Association study of 21 circadian genes with bipolar I disorder, schizoaffective disorder, and schizophrenia.
More...