Property Summary

NCBI Gene PubMed Count 26
PubMed Score 66.42
PubTator Score 31.44

Knowledge Summary

Patent (2,086)

TINX Plot

  Disease Sources (4)

Disease Target Count
Endometriosis 535
Refractive Errors 18
Disease Target Count P-value
pilocytic astrocytoma 3086 3.34213263205744E-8
group 3 medulloblastoma 2254 1.16705532107045E-4
atypical teratoid / rhabdoid tumor 4369 0.00101753424182133
medulloblastoma, large-cell 6234 0.00156160035986296
astrocytic glioma 2241 0.00200784021941986
primitive neuroectodermal tumor 3031 0.00257906848914502
glioblastoma 5572 0.00266833109527521
interstitial cystitis 2299 0.00420010846510193
nasopharyngeal carcinoma 1056 0.00684764228881848
chronic rhinosinusitis 512 0.00865131537163251
oligodendroglioma 2849 0.0130978817532785
adult high grade glioma 2148 0.0168530063668741
Pick disease 1893 0.0179798748554773
ependymoma 2514 0.0184970145493368
Disease Target Count Z-score Confidence
Refractive error 43 0.0 2.0
Disease Target Count Z-score Confidence
Periventricular nodular heterotopia 26 3.357 1.7
Bipolar Disorder 266 3.253 1.6

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma -3.400 0.002
ependymoma -3.000 0.018
oligodendroglioma -2.700 0.013
glioblastoma -2.300 0.003
group 3 medulloblastoma -4.800 0.000
atypical teratoid / rhabdoid tumor -3.400 0.001
medulloblastoma, large-cell -4.300 0.002
primitive neuroectodermal tumor -3.000 0.003
interstitial cystitis -1.100 0.004
adult high grade glioma -2.000 0.017
pilocytic astrocytoma -4.700 0.000
nasopharyngeal carcinoma -1.200 0.007
Pick disease 1.700 0.018
chronic rhinosinusitis -1.588 0.009

Synonym

Accession Q92753 Q8WX73
Symbols RZRB
NR1F2
ROR-BETA
RZR-BETA
bA133M9.1

Gene

  Ortholog (13)

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

 GO Component (2)

Gene RIF (10)

PMID Text
25816151 Retinoic acid-related orphan receptor RORbeta, circadian rhythm abnormalities and tumorigenesis
25789810 associations between NR1D1, RORA and RORB genes and bipolar disorder.(
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of RAR-related orphan receptor B (RORB) in primary human brain microvascular endothelial cells
24125721 these data demonstrate that Rorbeta regulates known osteogenic pathways, and may represent a novel therapeutic target for age-associated bone loss.
23333304 Microarray analysis indicates HIV-1 Tat-induced upregulation of RAR-related orphan receptor B (RORB) in primary human brain microvascular endothelial cells
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20201926 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
19909500 Observational study of gene-disease association. (HuGE Navigator)
19839995 Observational study of gene-disease association. (HuGE Navigator)
11849752 In the suprachiasmatic nucleus, ROR beta mRNA signals showed a peak at early daytime and a trough at early nighttime. ROR beta is a transcription factor possibly related to the circadian pacemaking system.

AA Sequence

MCENQLKTKADATAQIEVIPCKICGDKSSGIHYGVITCEGCKGFFRRSQQNNASYSCPRQRNCLIDRTNR      1 - 70
NRCQHCRLQKCLALGMSRDAVKFGRMSKKQRDSLYAEVQKHQQRLQEQRQQQSGEAEALARVYSSSISNG     71 - 140
LSNLNNETSGTYANGHVIDLPKSEGYYNVDSGQPSPDQSGLDMTGIKQIKQEPIYDLTSVPNLFTYSSFN    141 - 210
NGQLAPGITMTEIDRIAQNIIKSHLETCQYTMEELHQLAWQTHTYEEIKAYQSKSREALWQQCAIQITHA    211 - 280
IQYVVEFAKRITGFMELCQNDQILLLKSGCLEVVLVRMCRAFNPLNNTVLFEGKYGGMQMFKALGSDDLV    281 - 350
NEAFDFAKNLCSLQLTEEEIALFSSAVLISPDRAWLIEPRKVQKLQEKIYFALQHVIQKNHLDDETLAKL    351 - 420
IAKIPTITAVCNLHGEKLQVFKQSHPEIVNTLFPPLYKELFNPDCATGCK                        421 - 470
//

Text Mined References (27)

PMID Year Title
25816151 2015 Retinoic acid-related orphan receptor ROR?, circadian rhythm abnormalities and tumorigenesis (Review).
25789810 2015 Investigation of associations between NR1D1, RORA and RORB genes and bipolar disorder.
24125721 2013 Identification of Ror? targets in cultured osteoblasts and in human bone.
23555304 2013 Dynamic circadian protein-protein interaction networks predict temporal organization of cellular functions.
23396134 2013 Genome-wide meta-analyses of multiancestry cohorts identify multiple new susceptibility loci for refractive error and myopia.
22589738 2012 Genome-wide association for abdominal subcutaneous and visceral adipose reveals a novel locus for visceral fat in women.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20201926 2010 Human variation in alcohol response is influenced by variation in neuronal signaling genes.
19909500 2009 Evidence for genetic association of RORB with bipolar disorder.
19839995 2009 Association study of 21 circadian genes with bipolar I disorder, schizoaffective disorder, and schizophrenia.
More...