Property Summary

NCBI Gene PubMed Count 46
Grant Count 18
R01 Count 8
Funding $1,394,373.61
PubMed Score 104.49
PubTator Score 118.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Gene RIF (16)

PMID Text
26595808 Two genes, TNR (and TNK2), were found to have genetic variations linked to familial Parkinson's Disease.
23269478 TnC and TnR play important roles in nervous and immune systems. [Review]
21456020 results show that tenascin-R expression is tightly regulated in a spatiotemporal manner during brain development, especially cortical plate formation; its pattern of expression suggests a role for tenascin-R in corticogenesis
20950796 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
20673868 Observational study of gene-disease association. (HuGE Navigator)
20452482 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20202125 KIAA0510, the 3'-untranslated region of the tenascin-R gene, and tenascin-R are overexpressed in pilocytic astrocytomas
19890582 The researchers found evidence that the tenascin R gene is a potential susceptiblity or marker gene for IgA nephropathy.
19890582 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MGADGETVVLKNMLIGINLILLGSMIKPSECQLEVTTERVQRQSVEEEGGIANYNTSSKEQPVVFNHVYN      1 - 70
INVPLDNLCSSGLEASAEQEVSAEDETLAEYMGQTSDHESQVTFTHRINFPKKACPCASSAQVLQELLSR     71 - 140
IEMLEREVSVLRDQCNANCCQESAATGQLDYIPHCSGHGNFSFESCGCICNEGWFGKNCSEPYCPLGCSS    141 - 210
RGVCVDGQCICDSEYSGDDCSELRCPTDCSSRGLCVDGECVCEEPYTGEDCRELRCPGDCSGKGRCANGT    211 - 280
CLCEEGYVGEDCGQRQCLNACSGRGQCEEGLCVCEEGYQGPDCSAVAPPEDLRVAGISDRSIELEWDGPM    281 - 350
AVTEYVISYQPTALGGLQLQQRVPGDWSGVTITELEPGLTYNISVYAVISNILSLPITAKVATHLSTPQG    351 - 420
LQFKTITETTVEVQWEPFSFSFDGWEISFIPKNNEGGVIAQVPSDVTSFNQTGLKPGEEYIVNVVALKEQ    421 - 490
ARSPPTSASVSTVIDGPTQILVRDVSDTVAFVEWIPPRAKVDFILLKYGLVGGEGGRTTFRLQPPLSQYS    491 - 560
VQALRPGSRYEVSVSAVRGTNESDSATTQFTTEIDAPKNLRVGSRTATSLDLEWDNSEAEVQEYKVVYST    561 - 630
LAGEQYHEVLVPRGIGPTTRATLTDLVPGTEYGVGISAVMNSQQSVPATMNARTELDSPRDLMVTASSET    631 - 700
SISLIWTKASGPIDHYRITFTPSSGIASEVTVPKDRTSYTLTDLEPGAEYIISVTAERGRQQSLESTVDA    701 - 770
FTGFRPISHLHFSHVTSSSVNITWSDPSPPADRLILNYSPRDEEEEMMEVSLDATKRHAVLMGLQPATEY    771 - 840
IVNLVAVHGTVTSEPIVGSITTGIDPPKDITISNVTKDSVMVSWSPPVASFDYYRVSYRPTQVGRLDSSV    841 - 910
VPNTVTEFTITRLNPATEYEISLNSVRGREESERICTLVHTAMDNPVDLIATNITPTEALLQWKAPVGEV    911 - 980
ENYVIVLTHFAVAGETILVDGVSEEFRLVDLLPSTHYTATMYATNGPLTSGTISTNFSTLLDPPANLTAS    981 - 1050
EVTRQSALISWQPPRAEIENYVLTYKSTDGSRKELIVDAEDTWIRLEGLLENTDYTVLLQAAQDTTWSSI   1051 - 1120
TSTAFTTGGRVFPHPQDCAQHLMNGDTLSGVYPIFLNGELSQKLQVYCDMTTDGGGWIVFQRRQNGQTDF   1121 - 1190
FRKWADYRVGFGNVEDEFWLGLDNIHRITSQGRYELRVDMRDGQEAAFASYDRFSVEDSRNLYKLRIGSY   1191 - 1260
NGTAGDSLSYHQGRPFSTEDRDNDVAVTNCAMSYKGAWWYKNCHRTNLNGKYGESRHSQGINWYHWKGHE   1261 - 1330
FSIPFVEMKMRPYNHRLMAGRKRQSLQF                                             1331 - 1358
//

Text Mined References (47)

PMID Year Title
26595808 2016 Whole-Exome Sequencing in Familial Parkinson Disease.
23269478 2013 Tenascins and inflammation in disorders of the nervous system.
22730557 2012 Homozygous deletion of Tenascin-R in a patient with intellectual disability.
22634605 2012 Tenascin-R: role in the central nervous system.
21956439 2012 Genome-wide association study of alcohol dependence implicates KIAA0040 on chromosome 1q.
21456020 2011 Spatiotemporal distribution of tenascin-R in the developing human cerebral cortex parallels neuronal migration.
20950796 2011 Candidate gene analysis of the human natural killer-1 carbohydrate pathway and perineuronal nets in schizophrenia: B3GAT2 is associated with disease risk and cortical surface area.
20673868 2010 A genetic association study of maternal and fetal candidate genes that predispose to preterm prelabor rupture of membranes (PROM).
20452482 2010 Identification of fetal and maternal single nucleotide polymorphisms in candidate genes that predispose to spontaneous preterm labor with intact membranes.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...