Property Summary

NCBI Gene PubMed Count 21
Grant Count 43
R01 Count 29
Funding $5,903,284.82
PubMed Score 213.57
PubTator Score 34.70

Knowledge Summary

Patent

No data available

Expression

Gene RIF (7)

PMID Text
25472762 In human breast cancer cell lines, S14 expression was highest in those representing the luminal subtype compared to those cell lines with basal characteristics.
21821901 N-terminally truncated human Thrsp and its selenomethionyl derivative were collected to 4.0, 3.0 and 3.6 A resolution
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18299245 human Spot 14 protein might regulate the p53 target gene, p21(WAF1/Cip1), via its direct interaction with the thyroid receptor or other p53 coactivators, such as Zac1.
17418816 These findings provide a molecular rationale for the role of hS14 in TR-dependent transcriptional activation of the expression of specific genes.
12960053 significantly greater thyroid hormone response for the human promoter, compared with the rat.

AA Sequence

MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDV      1 - 70
DHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQE     71 - 140
MTGQVW                                                                    141 - 146
//

Text Mined References (22)

PMID Year Title
25472762 2014 Modulation of tumor fatty acids, through overexpression or loss of thyroid hormone responsive protein spot 14 is associated with altered growth and metastasis.
25416956 2014 A proteome-scale map of the human interactome network.
25231870 2014 Parent-of-origin-specific allelic associations among 106 genomic loci for age at menarche.
21821901 2011 Expression, purification and preliminary crystallographic analysis of human thyroid hormone responsive protein.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18299245 2008 Human Spot 14 protein is a p53-dependent transcriptional coactivator via the recruitment of thyroid receptor and Zac1.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17418816 2007 Human spot 14 protein interacts physically and functionally with the thyroid receptor.
16712791 2006 Identification of intrahepatic cholangiocarcinoma related genes by comparison with normal liver tissues using expressed sequence tags.
More...