Property Summary

NCBI Gene PubMed Count 17
Grant Count 447
R01 Count 296
Funding $36,658,715.46
PubMed Score 673.37
PubTator Score 5.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Multiple myeloma 1.659 0.000
non primary Sjogren syndrome sicca 1.400 0.019
ovarian cancer 1.500 0.006

Synonym

Accession Q92747 A4D276 B4DLQ7 D6W5S1 Q7Z5U8 Q86WU5 Q8IXQ0
Symbols Arc40
SOP2L
HEL-68
SOP2Hs
HEL-S-307

Gene

Gene RIF (4)

PMID Text
20570966 Genome-wide association study of gene-disease association. (HuGE Navigator)
19145645 data implicate ARPC1A as a novel target for the 7q21-q22 amplification and a regulator of cell migration and invasion in pancreatic cancer
18187620 Knockdown of actin related protein 2/3 complex, subunit 1A, 41kDa (ARPC1A) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17072959 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MSLHQFLLEPITCHAWNRDRTQIALSPNNHEVHIYKKNGSQWVKAHELKEHNGHITGIDWAPKSDRIVTC      1 - 70
GADRNAYVWSQKDGVWKPTLVILRINRAATFVKWSPLENKFAVGSGARLISVCYFESENDWWVSKHIKKP     71 - 140
IRSTVLSLDWHPNNVLLAAGSCDFKCRVFSAYIKEVDEKPASTPWGSKMPFGQLMSEFGGSGTGGWVHGV    141 - 210
SFSASGSRLAWVSHDSTVSVADASKSVQVSTLKTEFLPLLSVSFVSENSVVAAGHDCCPMLFNYDDRGCL    211 - 280
TFVSKLDIPKQSIQRNMSAMERFRNMDKRATTEDRNTALETLHQNSITQVSIYEVDKQDCRKFCTTGIDG    281 - 350
AMTIWDFKTLESSIQGLRIM                                                      351 - 370
//

Text Mined References (19)

PMID Year Title
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21533175 2011 Eight common genetic variants associated with serum DHEAS levels suggest a key role in ageing mechanisms.
21269460 2011 Initial characterization of the human central proteome.
20570966 2010 Fucosyltransferase 2 (FUT2) non-secretor status is associated with Crohn's disease.
19145645 2009 Characterization of the 7q21-q22 amplicon identifies ARPC1A, a subunit of the Arp2/3 complex, as a regulator of cell migration and invasion in pancreatic cancer.
19056867 2009 Large-scale proteomics and phosphoproteomics of urinary exosomes.
17353931 2007 Large-scale mapping of human protein-protein interactions by mass spectrometry.
17072959 2006 Lack of association between UGT1A7, UGT1A9, ARP, SPINK1 and CFTR gene polymorphisms and pancreatic cancer in Italian patients.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15635413 2005 Nucleolar proteome dynamics.
More...