Property Summary

NCBI Gene PubMed Count 212
Grant Count 119
R01 Count 75
Funding $19,335,185.04
PubMed Score 567.52
PubTator Score 319.60

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92743 D3DRE4 Q9UNS5
Symbols L56
HtrA
ARMD7
ORF480
PRSS11
CARASIL
CADASIL2

Gene

PANTHER Protein Class (3)

PDB

2JOA   2YTW   3NUM   3NWU   3NZI   3TJN   3TJO   3TJQ  

Gene RIF (224)

PMID Text
27125063 Human HTRA1 expression is enhanced by Age-related macular degeneration specific indel mutation in the promoter region of HTRA1 gene, and this enhanced HTRA1 may be concerned with induce retinal neovasucularization.
26708185 correlation between TGFb1 and pSmad2 as well as between HtrA1 and TGFb1 and the very significant increase of Ki67 in stromal compartment of eutopic endometrium suggest a possible involvement of HtrA1 in the pathogenesis of endometriosis.
26427389 Studies indicate that the high-risk allele of the 10q26 locus encompasses three genes, PLEKHA1, ARMS2, and HTRA1 with high linkage disequilibrium.
26403966 HtrA1 expression was closely related to EMT, which might be a potential mechanism underlying metastasis of HCC
26337002 The growth of choroidal neovascularization in AMD would be affected by 2 genes: MMP20, a newly confirmed gene expressed in the retina, and ARMS2/HTRA1, a well-known susceptibility gene for AMD.
26310622 Two synonymous polymorphisms in exon 1 of the HTRA1 gene result in a protein with altered thermophoretic properties.
26187609 significant increase of serum HtrA1 in early-onset pre-eclampsia
26063658 heterozygous HTRA1 mutations are an important cause of familial small vessel disease
26035313 Results does not conclusively support HTRA1 role as a tumor suppressor but suggest its possible prognostic role in many human tumors.
25776486 It was concluded that high expression of HtrA1 could significantly reverse multidrug resistance of hepatoma cells by targeting XIAP.
More...

AA Sequence

MQIPRAALLPLLLLLLAAPASAQLSRAGRSAPLAAGCPDRCEPARCPPQPEHCEGGRARDACGCCEVCGA      1 - 70
PEGAACGLQEGPCGEGLQCVVPFGVPASATVRRRAQAGLCVCASSEPVCGSDANTYANLCQLRAASRRSE     71 - 140
RLHRPPVIVLQRGACGQGQEDPNSLRHKYNFIADVVEKIAPAVVHIELFRKLPFSKREVPVASGSGFIVS    141 - 210
EDGLIVTNAHVVTNKHRVKVELKNGATYEAKIKDVDEKADIALIKIDHQGKLPVLLLGRSSELRPGEFVV    211 - 280
AIGSPFSLQNTVTTGIVSTTQRGGKELGLRNSDMDYIQTDAIINYGNSGGPLVNLDGEVIGINTLKVTAG    281 - 350
ISFAIPSDKIKKFLTESHDRQAKGKAITKKKYIGIRMMSLTSSKAKELKDRHRDFPDVISGAYIIEVIPD    351 - 420
TPAEAGGLKENDVIISINGQSVVSANDVSDVIKRESTLNMVVRRGNEDIMITVIPEEIDP              421 - 480
//

Text Mined References (212)

PMID Year Title
27125063 2015 HTRA1 Overexpression Induces the Exudative Form of Age-related Macular Degeneration.
26708185 2015 High temperature requirement A1, transforming growth factor beta1, phosphoSmad2 and Ki67 in eutopic and ectopic endometrium of women with endometriosis.
26427389 2016 Gene Structure of the 10q26 Locus: A Clue to Cracking the ARMS2/HTRA1 Riddle?
26403966 2015 HtrA1 regulates epithelial-mesenchymal transition in hepatocellular carcinoma.
26337002 2015 MMP20 and ARMS2/HTRA1 Are Associated with Neovascular Lesion Size in Age-Related Macular Degeneration.
26310622 2015 Synonymous variants in HTRA1 implicated in AMD susceptibility impair its capacity to regulate TGF-? signaling.
26187609 2015 Serum HtrA1 is differentially regulated between early-onset and late-onset preeclampsia.
26063658 2015 Heterozygous HTRA1 mutations are associated with autosomal dominant cerebral small vessel disease.
26035313 2015 HtrA1: Its future potential as a novel biomarker for cancer.
25776486 2015 HtrA1 resensitizes multidrug-resistant hepatocellular carcinoma cells by targeting XIAP.
More...