Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.43
PubTator Score 6.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
oligodendroglioma 1.100 0.006
glioblastoma -1.700 0.001
medulloblastoma -1.600 0.031
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma, large-cell -2.200 0.007
primitive neuroectodermal tumor -1.700 0.049
breast carcinoma -1.300 0.006
pilocytic astrocytoma -1.700 0.001
non-inflammatory breast cancer -3.000 0.000
Pick disease -1.300 0.001
facioscapulohumeral dystrophy 1.400 0.030

Synonym

Accession Q92737 Q49AU5 Q6PI03
Symbols RRP22

Gene

Gene RIF (4)

PMID Text
21631628 Both 5'-CpG island hypermethylation and histone modifications contribute to the frequent and prognostically unfavorable transcriptional downregulation of RRP22 in malignant gliomas.
21264544 RRP22 is a special neural tumor suppressor for human astrocytomas
20646714 chromosome 22 have specific motor deficits in axial stability and graphomotor skills.
15833841 RRP22 localizes to the nucleolus in a GTP-dependent manner and can serve as a potential tumor suppressor.

AA Sequence

MGGSLRVAVLGAPGVGKTAIIRQFLFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPG      1 - 70
GPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRLRFGP     71 - 140
RRALAALVRRGWRCGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM           141 - 203
//

Text Mined References (11)

PMID Year Title
25086665 2014 Genome-wide association study identifies multiple susceptibility loci for pancreatic cancer.
21631628 2012 DNA hypermethylation and histone modifications downregulate the candidate tumor suppressor gene RRP22 on 22q12 in human gliomas.
21264544 2012 RRP22: a novel neural tumor suppressor for astrocytoma.
20646714 2010 22q11.2 deletion syndrome: are motor deficits more than expected for IQ level?
17984325 2007 Regulation of atrial natriuretic peptide secretion by a novel Ras-like protein.
15833841 2005 RRP22 is a farnesylated, nucleolar, Ras-related protein with tumor suppressor potential.
15731001 2005 The Ras superfamily at a glance.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10591208 1999 The DNA sequence of human chromosome 22.
More...