Property Summary

NCBI Gene PubMed Count 10
PubMed Score 4.43
PubTator Score 6.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Astrocytoma, Pilocytic -1.700 5.6e-04
atypical teratoid / rhabdoid tumor -2.000 1.2e-04
Breast cancer -1.700 1.4e-14
breast carcinoma -1.300 5.9e-03
facioscapulohumeral dystrophy 1.400 3.0e-02
glioblastoma -1.200 4.2e-03
group 4 medulloblastoma -1.400 3.3e-02
malignant mesothelioma 1.200 5.0e-04
medulloblastoma, large-cell -2.200 6.7e-03
oligodendroglioma 1.100 6.4e-03
Pick disease -1.300 8.1e-04
primitive neuroectodermal tumor -1.700 4.9e-02

Gene RIF (4)

AA Sequence

MGGSLRVAVLGAPGVGKTAIIRQFLFGDYPERHRPTDGPRLYRPAVLLDGAVYDLSIRDGDVAGPGSSPG      1 - 70
GPEEWPDAKDWSLQDTDAFVLVYDICSPDSFDYVKALRQRIAETRPAGAPEAPILVVGNKRDRQRLRFGP     71 - 140
RRALAALVRRGWRCGYLECSAKYNWHVLRLFRELLRCALVRARPAHPALRLQGALHPARCSLM           141 - 203
//

Text Mined References (11)

PMID Year Title