Property Summary

NCBI Gene PubMed Count 31
Grant Count 68
R01 Count 60
Funding $4,853,641.27
PubMed Score 157.33
PubTator Score 54.24

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92734 D3DN49 G5E9V1 K0J5S8 K0J6K2 Q15656 Q969I2
Symbols TF6
HMSNP
SPG57
TRKT3

Gene

TFG

Gene RIF (15)

PMID Text
25725944 HMSN-P caused by p.Pro285Leu mutation in TFG is not confined to patients with Far East ancestry.
25586378 TFG functions at the endoplasmic reticulum (ER)/ER-Golgi intermediate compartments (ERGIC) interface to locally concentrate COPII-coated transport carriers and link exit sites on the ER to ERGIC membranes.
25098539 TFG plays an important role in the protein secretory pathways that are essential for proper functioning of the human peripheral nervous system.
24999993 TRIM68 targets TFG, a novel regulator of IFN production, and in doing so turns off and limits type I IFN production in response to anti-viral detection systems
24613659 Study demonstrates that TFG1 physiologically functions to inhibit the protein degradation system, resulting in an increase in ER resident proteins and ER stress; the P285L mutant substantially enhances these consequences
23810392 TFG plays a pivotal role in negative regulation of RNA-sensing, RIG-I-like receptor (RLR) family signaling pathways.
23553329 Whole-exome sequencing reveals that HMSN-P is caused by a mutation in the TRK-fused gene on chromosome 3q13.2
23479643 Inhibition of TFG function causes hereditary axon degeneration by impairing endoplasmic reticulum structure.
22883144 The TRK-fused gene is mutated in hereditary motor and sensory neuropathy with proximal dominant involvement.
22581839 results suggest that the oncogenic effect of the t(3;9) translocation may be due to the TFG-TEC chimeric protein and that fusion of the TFG (NTD) to the TEC protein produces a gain-of-function chimeric product
More...

AA Sequence

MNGQLDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFD      1 - 70
SSDLSFAIQCSRILKLTLFVNGQPRPLESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDT     71 - 140
VDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPSAPAEDRSGTPDSI    141 - 210
ASSSSAAHPPGVQPQQPPYTGAQTQAGQIEGQMYQQYQQQAGYGAQQPQAPPQQPQQYGIQYSASYSQQT    211 - 280
GPQQPQQFQGYGQQPTSQAPAPAFSGQPQQLPAQPPQQYQASNYPAQTYTAQTSQPTNYTVAPASQPGMA    281 - 350
PSQPGAYQPRPGFTSLPGSTMTPPPSGPNPYARNRPPFGQGYTQPGPGYR                        351 - 400
//

Text Mined References (42)

PMID Year Title
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
25725944 2015 HMSN-P caused by p.Pro285Leu mutation in TFG is not confined to patients with Far East ancestry.
25586378 2015 TFG clusters COPII-coated transport carriers and promotes early secretory pathway organization.
25416956 2014 A proteome-scale map of the human interactome network.
25098539 2014 A novel TFG mutation causes Charcot-Marie-Tooth disease type 2 and impairs TFG function.
24999993 2014 TRIM68 negatively regulates IFN-? production by degrading TRK fused gene, a novel driver of IFN-? downstream of anti-viral detection systems.
24613659 2014 Evidence of TRK-Fused Gene (TFG1) function in the ubiquitin-proteasome system.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23810392 2013 Negative regulation of RIG-I-mediated antiviral signaling by TRK-fused gene (TFG) protein.
More...