Property Summary

Ligand Count 905
NCBI Gene PubMed Count 1,028
PubMed Score 3765.20
PubTator Score 2681.61

Knowledge Summary

Patent (63,928)


  Disease (6)

Disease Target Count P-value
ovarian cancer 8520 7.0e-07
psoriasis 6694 6.0e-04
lung cancer 4740 3.0e-03


  Differential Expression (3)

Disease log2 FC p
lung cancer -1.100 3.0e-03
ovarian cancer -1.300 7.0e-07
psoriasis -1.200 6.0e-04

Gene RIF (1042)

AA Sequence

LLEMLNAHVLRGCKSSITGSECSPAEDSKSKEGSQNPQSQ                                  491 - 530

Text Mined References (1031)

PMID Year Title