Property Summary

NCBI Gene PubMed Count 24
Grant Count 28
R01 Count 17
Funding $2,369,488.17
PubMed Score 116.33
PubTator Score 27.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
astrocytic glioma -1.400 0.007
ependymoma -2.100 0.008
oligodendroglioma -1.100 0.034
psoriasis 3.900 0.000
glioblastoma -2.100 0.001
sonic hedgehog group medulloblastoma -2.800 0.000
atypical teratoid / rhabdoid tumor -2.600 0.000
medulloblastoma, large-cell -3.300 0.000
primitive neuroectodermal tumor -1.700 0.002
non-small cell lung cancer -1.854 0.000
lung cancer -5.800 0.000
adult high grade glioma -2.200 0.000
pilocytic astrocytoma -1.600 0.000

Gene RIF (9)

PMID Text
25531777 These results reveal a previously unappreciated mechanism through which Rnd1 restrains activation of Ras-MAPK signalling and breast tumour initiation and progression
23603360 Data indicate that Rnd1 efficiently displaces Rac1 from its complex with Plexin-B1 but not vice versa.
22357615 role of the N-terminal region in signaling; Rnd1 and Rnd3 have a KERRA (Lys-Glu-Arg-Arg-Ala) sequence of amino acids in their N-terminus, which functions as the lipid raft-targeting determinant; the sequence mediates lipid raft targeting of p190 RhoGAP correlated with its activation
21610070 Rnd1 does not play a role in the activation of plexin-C1 and -D1
18996843 SCG10 acts as an effector downstream of Rnd1 to regulate axon extensions by modulating microtubule organization.
18976975 Knockdown of Rho family GTPase 1 (RND1) by siRNA inhibits HIV-1 replication in HeLa P4/R5 cells
17916560 Binding of Rac1, Rnd1, and RhoD to a novel Rho GTPase interaction motif destabilizes dimerization of the plexin-B1 effector domain
16311049 The RND1 mRNA expression levels increased significantly after gestation in myometria.
11940653 Socius is a novel Rnd GTPase-interacting protein involved in disassembly of actin stress fibers

AA Sequence

MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSG      1 - 70
SPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELS     71 - 140
HQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHL    141 - 210
PSRSELISSTFKKEKAKSCSIM                                                    211 - 232
//

Text Mined References (25)

PMID Year Title
25531777 2015 The Rho GTPase Rnd1 suppresses mammary tumorigenesis and EMT by restraining Ras-MAPK signalling.
23825416 2013 A multilevel screening strategy defines a molecular fingerprint of proregenerative olfactory ensheathing cells and identifies SCARB2, a protein that improves regenerative sprouting of injured sensory spinal axons.
23603360 2013 Interaction characteristics of Plexin-B1 with Rho family proteins.
23201090 2013 miR-199a-5p regulates urothelial permeability and may play a role in bladder pain syndrome.
22357615 2012 Rnd1 and Rnd3 targeting to lipid raft is required for p190 RhoGAP activation.
21926972 2011 Large-scale genome-wide association analysis of bipolar disorder identifies a new susceptibility locus near ODZ4.
21610070 2011 Structural basis of Rnd1 binding to plexin Rho GTPase binding domains (RBDs).
19843518 2009 Structure and function of the intracellular region of the plexin-b1 transmembrane receptor.
18996843 2009 Rnd1 regulates axon extension by enhancing the microtubule destabilizing activity of SCG10.
17916560 2007 Binding of Rac1, Rnd1, and RhoD to a novel Rho GTPase interaction motif destabilizes dimerization of the plexin-B1 effector domain.
More...