Property Summary

NCBI Gene PubMed Count 27
PubMed Score 119.78
PubTator Score 27.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -2.200 8.5e-05
astrocytic glioma -1.400 7.3e-03
Astrocytoma, Pilocytic -1.700 7.3e-06
atypical teratoid / rhabdoid tumor -2.600 5.1e-08
ependymoma -2.100 7.5e-03
glioblastoma -1.700 2.3e-06
group 3 medulloblastoma -1.900 5.9e-03
lung cancer -3.200 9.2e-05
medulloblastoma, large-cell -3.300 1.9e-05
non-small cell lung cancer -1.854 3.0e-08
oligodendroglioma -1.100 3.4e-02
primitive neuroectodermal tumor -1.700 2.0e-03
psoriasis 1.600 1.2e-04

Gene RIF (12)

AA Sequence

MKERRAPQPVVARCKLVLVGDVQCGKTAMLQVLAKDCYPETYVPTVFENYTACLETEEQRVELSLWDTSG      1 - 70
SPYYDNVRPLCYSDSDAVLLCFDISRPETVDSALKKWRTEILDYCPSTRVLLIGCKTDLRTDLSTLMELS     71 - 140
HQKQAPISYEQGCAIAKQLGAEIYLEGSAFTSEKSIHSIFRTASMLCLNKPSPLPQKSPVRSLSKRLLHL    141 - 210
PSRSELISSTFKKEKAKSCSIM                                                    211 - 232
//

Text Mined References (28)

PMID Year Title