Property Summary

NCBI Gene PubMed Count 26
Grant Count 30
R01 Count 13
Funding $7,025,667.18
PubMed Score 242.28
PubTator Score 280.13

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
interstitial cystitis -1.200 0.009
psoriasis -1.300 0.000

Gene RIF (8)

PMID Text
25337216 PTPRU is required for gastric cancer cell proliferation and migration.
24876153 High PTPRU expression is associated with glioma growth and motility.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19528353 Gene expression of GLEPP-1 is decreased in podocytes from women with preeclampsia.
18854154 Knockdown of protein tyrosine phosphatase, receptor type U (PTPRU) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
16574648 PCP-2 may play an important role in the maintenance of epithelial integrity, and a loss of its regulatory function may be an alternative mechanism for activating beta-catenin signaling.
16564554 Reduced expression of both synaptopodin and GLEPP1 is associated with poor response to steroid therapy in primary focal segmental glomerulosclerosis.
12501215 Expressed in a cell density-dependent fashion, PCP-2 interacts directly with its substrate beta-catenin, independent of the tyrosine phosphorylation state of beta-catenin.

AA Sequence

MARAQALVLALTFQLCAPETETPAAGCTFEEASDPAVPCEYSQAQYDDFQWEQVRIHPGTRAPADLPHGS      1 - 70
YLMVNTSQHAPGQRAHVIFQSLSENDTHCVQFSYFLYSRDGHSPGTLGVYVRVNGGPLGSAVWNMTGSHG     71 - 140
RQWHQAELAVSTFWPNEYQVLFEALISPDRRGYMGLDDILLLSYPCAKAPHFSRLGDVEVNAGQNASFQC    141 - 210
MAAGRAAEAERFLLQRQSGALVPAAGVRHISHRRFLATFPLAAVSRAEQDLYRCVSQAPRGAGVSNFAEL    211 - 280
IVKEPPTPIAPPQLLRAGPTYLIIQLNTNSIIGDGPIVRKEIEYRMARGPWAEVHAVSLQTYKLWHLDPD    281 - 350
TEYEISVLLTRPGDGGTGRPGPPLISRTKCAEPMRAPKGLAFAEIQARQLTLQWEPLGYNVTRCHTYTVS    351 - 420
LCYHYTLGSSHNQTIRECVKTEQGVSRYTIKNLLPYRNVHVRLVLTNPEGRKEGKEVTFQTDEDVPSGIA    421 - 490
AESLTFTPLEDMIFLKWEEPQEPNGLITQYEISYQSIESSDPAVNVPGPRRTISKLRNETYHVFSNLHPG    491 - 560
TTYLFSVRARTGKGFGQAALTEITTNISAPSFDYADMPSPLGESENTITVLLRPAQGRGAPISVYQVIVE    561 - 630
EERARRLRREPGGQDCFPVPLTFEAALARGLVHYFGAELAASSLPEAMPFTVGDNQTYRGFWNPPLEPRK    631 - 700
AYLIYFQAASHLKGETRLNCIRIARKAACKESKRPLEVSQRSEEMGLILGICAGGLAVLILLLGAIIVII    701 - 770
RKGRDHYAYSYYPKPVNMTKATVNYRQEKTHMMSAVDRSFTDQSTLQEDERLGLSFMDTHGYSTRGDQRS    771 - 840
GGVTEASSLLGGSPRRPCGRKGSPYHTGQLHPAVRVADLLQHINQMKTAEGYGFKQEYESFFEGWDATKK    841 - 910
KDKVKGSRQEPMPAYDRHRVKLHPMLGDPNADYINANYIDGYHRSNHFIATQGPKPEMVYDFWRMVWQEH    911 - 980
CSSIVMITKLVEVGRVKCSRYWPEDSDTYGDIKIMLVKTETLAEYVVRTFALERRGYSARHEVRQFHFTA    981 - 1050
WPEHGVPYHATGLLAFIRRVKASTPPDAGPIVIHCSAGTGRTGCYIVLDVMLDMAECEGVVDIYNCVKTL   1051 - 1120
CSRRVNMIQTEEQYIFIHDAILEACLCGETTIPVSEFKATYKEMIRIDPQSNSSQLREEFQTLNSVTPPL   1121 - 1190
DVEECSIALLPRNRDKNRSMDVLPPDRCLPFLISTDGDSNNYINAALTDSYTRSAAFIVTLHPLQSTTPD   1191 - 1260
FWRLVYDYGCTSIVMLNQLNQSNSAWPCLQYWPEPGRQQYGLMEVEFMSGTADEDLVARVFRVQNISRLQ   1261 - 1330
EGHLLVRHFQFLRWSAYRDTPDSKKAFLHLLAEVDKWQAESGDGRTIVHCLNGGGRSGTFCACATVLEMI   1331 - 1400
RCHNLVDVFFAAKTLRNYKPNMVETMDQYHFCYDVALEYLEGLESR                           1401 - 1446
//

Text Mined References (31)

PMID Year Title
25337216 2014 Knockdown of protein tyrosine phosphatase receptor U inhibits growth and motility of gastric cancer cells.
24876153 2014 Protein tyrosine phosphatase receptor U (PTPRU) is required for glioma growth and motility.
23535911 2013 Genome-wide scan revealed that polymorphisms in the PNPLA3, SAMM50, and PARVB genes are associated with development and progression of nonalcoholic fatty liver disease in Japan.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22219177 2012 A genome-wide search for loci interacting with known prostate cancer risk-associated genetic variants.
20889312 2010 A genome-wide meta-analysis identifies novel loci associated with schizophrenia and bipolar disorder.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19528353 2009 Decreased nephrin and GLEPP-1, but increased VEGF, Flt-1, and nitrotyrosine, expressions in kidney tissue sections from women with preeclampsia.
18951430 2008 Conduct disorder and ADHD: evaluation of conduct problems as a categorical and quantitative trait in the international multicentre ADHD genetics study.
More...