Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.27
PubTator Score 3.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 0.00380051674702345
esophageal adenocarcinoma 737 0.0405375974663912
Disease Target Count Z-score Confidence
Hermansky-Pudlak syndrome 43 4.352 2.2

Expression

  Differential Expression (2)

Disease log2 FC p
esophageal adenocarcinoma -1.200 0.041
osteosarcoma -1.035 0.004

Synonym

Accession Q92696 A8K5N2 D3DS69
Symbols PTAR3

Gene

PANTHER Protein Class (2)

  Ortholog (13)

Gene RIF (1)

PMID Text
20403997 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)

AA Sequence

MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRR      1 - 70
EVLQQLETQKSPEELAALVKAELGFLESCLRVNPKSYGTWHHRCWLLGRLPEPNWTRELELCARFLEVDE     71 - 140
RNFHCWDYRRFVATQAAVPPAEELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLK    141 - 210
ELELVQNAFFTDPNDQSAWFYHRWLLGRADPQDALRCLHVSRDEACLTVSFSRPLLVGSRMEILLLMVDD    211 - 280
SPLIVEWRTPDGRNRPSHVWLCDLPAASLNDQLPQHTFRVIWTAGDVQKECVLLKGRQEGWCRDSTTDEQ    281 - 350
LFRCELSVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFQTLKAVDPMRAT    351 - 420
YLDDLRSKFLLENSVLKMEYAEVRVLHLAHKDLTVLCHLEQLLLVTHLDLSHNRLRTLPPALAALRCLEV    421 - 490
LQASDNAIESLDGVTNLPRLQELLLCNNRLQQPAVLQPLASCPRLVLLNLQGNPLCQAVGILEQLAELLP    491 - 560
SVSSVLT                                                                   561 - 567
//

Text Mined References (18)

PMID Year Title
21269460 2011 Initial characterization of the human central proteome.
20403997 2010 Genetic variation in 3-hydroxy-3-methylglutaryl CoA reductase modifies the chemopreventive activity of statins for colorectal cancer.
18532927 2008 Rab geranylgeranylation occurs preferentially via the pre-formed REP-RGGT complex and is regulated by geranylgeranyl pyrophosphate.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15188402 2004 Proteins associated with type II bone morphogenetic protein receptor (BMPR-II) and identified by two-dimensional gel electrophoresis and mass spectrometry.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12620235 2003 Structure of Rab escort protein-1 in complex with Rab geranylgeranyltransferase.
12535645 2003 Structural determinants of Rab and Rab Escort Protein interaction: Rab family motifs define a conserved binding surface.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...