Property Summary

NCBI Gene PubMed Count 15
PubMed Score 4.31
PubTator Score 3.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 3.8e-03
esophageal adenocarcinoma 737 4.1e-02
Disease Target Count Z-score Confidence
Hermansky-Pudlak syndrome 42 4.451 2.2

Expression

  Differential Expression (2)

Disease log2 FC p
esophageal adenocarcinoma -1.200 4.1e-02
osteosarcoma -1.035 3.8e-03

Protein-protein Interaction (6)

Gene RIF (1)

AA Sequence

MHGRLKVKTSEEQAEAKRLEREQKLKLYQSATQAVFQKRQAGELDESVLELTSQILGANPDFATLWNCRR      1 - 70
EVLQQLETQKSPEELAALVKAELGFLESCLRVNPKSYGTWHHRCWLLGRLPEPNWTRELELCARFLEVDE     71 - 140
RNFHCWDYRRFVATQAAVPPAEELAFTDSLITRNFSNYSSWHYRSCLLPQLHPQPDSGPQGRLPEDVLLK    141 - 210
ELELVQNAFFTDPNDQSAWFYHRWLLGRADPQDALRCLHVSRDEACLTVSFSRPLLVGSRMEILLLMVDD    211 - 280
SPLIVEWRTPDGRNRPSHVWLCDLPAASLNDQLPQHTFRVIWTAGDVQKECVLLKGRQEGWCRDSTTDEQ    281 - 350
LFRCELSVEKSTVLQSELESCKELQELEPENKWCLLTIILLMRALDPLLYEKETLQYFQTLKAVDPMRAT    351 - 420
YLDDLRSKFLLENSVLKMEYAEVRVLHLAHKDLTVLCHLEQLLLVTHLDLSHNRLRTLPPALAALRCLEV    421 - 490
LQASDNAIESLDGVTNLPRLQELLLCNNRLQQPAVLQPLASCPRLVLLNLQGNPLCQAVGILEQLAELLP    491 - 560
SVSSVLT                                                                   561 - 567
//

Text Mined References (18)

PMID Year Title