Property Summary

NCBI Gene PubMed Count 71
PubMed Score 63.43
PubTator Score 42.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (5)

Expression

  Differential Expression (9)

Disease log2 FC p
ependymoma 1.800 0.000
osteosarcoma 1.927 0.000
atypical teratoid / rhabdoid tumor 2.800 0.000
glioblastoma 2.200 0.000
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 1.100 0.003
breast carcinoma 1.300 0.000
ductal carcinoma in situ 1.300 0.012
invasive ductal carcinoma 1.800 0.002

Synonym

Accession Q92692 A8K5L5 O75455 Q6IBI6 Q96J29
Symbols HVEB
PRR2
CD112
PVRL2
PVRR2

Gene

PANTHER Protein Class (1)

PDB

3R0N   4DFH   4DFI   4HZA  

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG
Horse OMA EggNOG
Cow OMA EggNOG
Pig OMA EggNOG
Xenopus OMA EggNOG

Gene RIF (28)

PMID Text
26982466 Soluble form of nectin-2 is required for exerting the resistance against HSV-2 infection.
26184725 Serum levels of nectin-2 may have diagnostic roles for colorectal cancer patients.
24924924 PVRL2, TOMM40 and APOE might be associated with human longevity.
24116228 Nectin-3 trans-interacts with Nectin-2 to promote lymphocyte and monocyte extravasation.
23465821 Chorionic gonadotropin induces vascular endothelial growth factor (VEGFA)-dependent downregulation of nectin 2, which increases the endothelial permeability in the coculture system.
22927415 Structure of Nectin-2 reveals determinants of homophilic and heterophilic interactions that control cell-cell adhesion.
21383766 Data show that a high expression of CD112 and CD155 (DNAM-1 ligands) on leukemic blasts.
20672350 Observational study of gene-disease association. (HuGE Navigator)
20662561 a possible etiologic role of PRR2 in nonsyndromic cleft lip with or without cleft palate
20634891 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTW      1 - 70
QRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTC     71 - 140
EFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVS    141 - 210
GTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDAT    211 - 280
LSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETP    281 - 350
NTAGAGATGGIIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM    351 - 420
PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPVPPGPPAVEDV    421 - 490
SLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV                          491 - 538
//

Text Mined References (77)

PMID Year Title
26982466 2016 Accumulation of a soluble form of human nectin-2 is required for exerting the resistance against herpes simplex virus type 2 infection in transfected cells.
26755705 2016 Identification of CD112R as a novel checkpoint for human T cells.
26184725 2016 Serum nectin-2 levels are diagnostic and prognostic in patients with colorectal carcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
24924924 2014 Genetic variants in PVRL2-TOMM40-APOE region are associated with human longevity in a Han Chinese population.
24755620 2014 Overrepresentation of glutamate signaling in Alzheimer's disease: network-based pathway enrichment using meta-analysis of genome-wide association studies.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24116228 2013 Nectin-3 (CD113) interacts with Nectin-2 (CD112) to promote lymphocyte transendothelial migration.
23758976 2013 Nectin-2 is a potential target for antibody therapy of breast and ovarian cancers.
23750010 2013 Drebrin preserves endothelial integrity by stabilizing nectin at adherens junctions.
More...