Property Summary

NCBI Gene PubMed Count 78
PubMed Score 62.86
PubTator Score 42.92

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 2.800 1.4e-07
breast carcinoma 1.200 8.9e-14
ductal carcinoma in situ 1.300 1.2e-02
ependymoma 1.700 1.2e-02
glioblastoma 2.200 3.9e-07
invasive ductal carcinoma 1.400 7.2e-03
osteosarcoma 1.927 1.6e-05
pediatric high grade glioma 1.600 1.2e-05
Pilocytic astrocytoma 1.100 2.7e-03

Protein-protein Interaction (5)

Gene RIF (33)

AA Sequence

MARAAALLPSRSPPTPLLWPLLLLLLLETGAQDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTW      1 - 70
QRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTC     71 - 140
EFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVS    141 - 210
GTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDAT    211 - 280
LSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETP    281 - 350
NTAGAGATGGIIGGIIAAIIATAVAATGILICRQQRKEQTLQGAEEDEDLEGPPSYKPPTPKAKLEAQEM    351 - 420
PSQLFTLGASEHSPLKTPYFDAGASCTEQEMPRYHELPTLEERSGPLHPGATSLGSPIPVPPGPPAVEDV    421 - 490
SLDLEDEEGEEEEEYLDKINPIYDALSYSSPSDSYQGKGFVMSRAMYV                          491 - 538
//

Text Mined References (83)

PMID Year Title