Property Summary

NCBI Gene PubMed Count 27
PubMed Score 12.57
PubTator Score 25.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
acute quadriplegic myopathy 1.527 1.3e-07
atypical teratoid / rhabdoid tumor 1.400 1.7e-07
dermatomyositis 1.500 1.3e-04
glioblastoma 1.300 7.1e-05
group 3 medulloblastoma 1.400 3.0e-03
juvenile dermatomyositis 1.068 1.7e-10
medulloblastoma, large-cell 1.200 7.2e-04
Multiple myeloma 1.176 4.0e-03
osteosarcoma -1.649 4.4e-05
ovarian cancer -1.100 9.5e-04
pancreatic ductal adenocarcinoma liver m... 1.146 1.5e-02
pediatric high grade glioma 1.100 2.7e-04
primitive neuroectodermal tumor 1.100 2.2e-04
Waldenstrons macroglobulinemia 1.653 1.2e-03

Gene RIF (11)

AA Sequence

MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLE      1 - 70
LSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDLFNCEVTNLNDYRESVFKLLP     71 - 140
QLTYLDGYDREDQEAPDSDAEVDGVDEEEEDEEGEDEEDEDDEDGEEEEFDEEDDEDEDVEGDEDDDEVS    141 - 210
EEEEEFGLDEEDEDEDEDEEEEEGGKGEKRKRETDDEGEDD                                 211 - 251
//

Text Mined References (36)

PMID Year Title