Property Summary

NCBI Gene PubMed Count 25
Grant Count 2
Funding $350,003
PubMed Score 11.20
PubTator Score 25.21

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92688 B2R9C7 O00655 P78458 P78459
Symbols APRIL
SSP29
PHAPI2

Gene

 Grant Application (2)

PDB

2ELL   2RR6  

Gene RIF (10)

PMID Text
25483709 Caspase-3-resistant uncleavable form of acidic leucine-rich nuclear phosphoprotein 32B potentiates leukemic cell apoptosis.
24823948 ANP32B is a nuclear target of henipavirus M proteins.
22705300 this is the first demonstration that ANP32B expression was down-regulated during differentiation induction of leukemic cells by all-trans retinoic acid.
22174317 The interaction of Rev with ANP32B is decreased by the presence of RRE
22174317 The interaction of Rev with ANP32B is decreased by the presence of RRE
20538007 the interaction of ANP32B with the core histones H3-H4 occurs on its concave side, and both the acidic and hydrophobic residues that compose the concave surface are critical for histone binding.
20015864 ANP32B is a direct substrate of caspase-3. It is cleaved at the sequence of Ala-Glu-Val-Asp, after Asp-163. The reduced expression of endogenous ANP32B by specific siRNA enhances caspase-3 activation & apoptosis induction by NSC606985 & etoposide.
19130553 The CK2 alpha' phosphorylates APRIL and therefore is responsible for the regulation of the nucleocytoplasmic translocation of CD83 mRNA.
18039846 recruitment of ANP32B onto the promoter region requires KLF5 and results in promoter region-specific histone incorporation and inhibition of histone acetylation by ANP32B
12522243 regulatory roles of oncoprotein ProT and tumor suppressor PHAP in apoptosis

AA Sequence

MDMKRRIHLELRNRTPAAVRELVLDNCKSNDGKIEGLTAEFVNLEFLSLINVGLISVSNLPKLPKLKKLE      1 - 70
LSENRIFGGLDMLAEKLPNLTHLNLSGNKLKDISTLEPLKKLECLKSLDLFNCEVTNLNDYRESVFKLLP     71 - 140
QLTYLDGYDREDQEAPDSDAEVDGVDEEEEDEEGEDEEDEDDEDGEEEEFDEEDDEDEDVEGDEDDDEVS    141 - 210
EEEEEFGLDEEDEDEDEDEEEEEGGKGEKRKRETDDEGEDD                                 211 - 251
//

Text Mined References (34)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25483709 2015 Caspase-3-resistant uncleavable form of acidic leucine-rich nuclear phosphoprotein 32B potentiates leukemic cell apoptosis.
25436638 2014 Genetic variants associated with serum thyroid stimulating hormone (TSH) levels in European Americans and African Americans from the eMERGE Network.
25416956 2014 A proteome-scale map of the human interactome network.
24823948 2014 ANP32B is a nuclear target of henipavirus M proteins.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22705300 2012 Acidic leucine-rich nuclear phosphoprotein 32 family member B (ANP32B) contributes to retinoic acid-induced differentiation of leukemic cells.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...