Property Summary

NCBI Gene PubMed Count 41
PubMed Score 289.75
PubTator Score 132.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
astrocytic glioma -2.800 1.6e-02
Astrocytoma, Pilocytic -4.100 1.3e-05
atypical teratoid / rhabdoid tumor -3.900 4.0e-06
ependymoma -4.400 4.9e-03
glioblastoma -2.500 2.3e-04
group 3 medulloblastoma -4.000 1.8e-02
interstitial cystitis 1.100 4.7e-03
lung cancer -1.100 2.6e-02
medulloblastoma, large-cell -4.000 7.3e-03
non-small cell lung cancer -2.072 1.6e-17
oligodendroglioma -3.200 3.2e-15
pancreatic cancer 1.200 2.2e-02
pancreatic carcinoma 1.200 2.2e-02
pediatric high grade glioma -2.900 1.5e-03
Pick disease -1.600 1.4e-02
primitive neuroectodermal tumor -4.100 1.5e-03

Synonym

Accession Q92686 Ng
Symbols RC3
hng

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (29)

AA Sequence

MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGG      1 - 70
AGGGPSGD                                                                   71 - 78
//

Text Mined References (46)

PMID Year Title