Property Summary

NCBI Gene PubMed Count 39
Grant Count 61
R01 Count 40
Funding $4,706,134.06
PubMed Score 268.45
PubTator Score 132.90

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
pancreatic cancer 1.200 0.022
astrocytoma -4.600 0.004
posterior fossa group B ependymoma -4.700 0.000
glioblastoma -4.300 0.000
oligodendroglioma -3.200 0.000
medulloblastoma -4.600 0.000
atypical teratoid / rhabdoid tumor -3.900 0.000
medulloblastoma, large-cell -4.000 0.007
primitive neuroectodermal tumor -4.100 0.002
non-small cell lung cancer -2.072 0.000
lung cancer -1.100 0.026
interstitial cystitis 1.100 0.005
pediatric high grade glioma -2.900 0.002
pilocytic astrocytoma -4.100 0.000
pancreatic carcinoma 1.200 0.022
Pick disease -1.600 0.014

Gene RIF (27)

PMID Text
26828755 Polymorphisms in NRGN are associated with schizophrenia, major depressive disorder and bipolar disorder in the Han Chinese population.
26826204 These results confirm an increase in CSF Ng concentration in patients with AD as previously reported and show that this is specific to AD and not seen in a range of other neurodegenerative diseases.
26698298 Neurogranin and YKL-40 are promising AD biomarkers, independent of and complementary to the established core Alzheimer's disease (AD) biomarkers, reflecting additional pathological changes in the course of AD
26373605 Cerebrospinal fluid neurogranin was increased in patients with Alzheimer's dementia, progressive mild cognitive impairment (MCI) and stable MCI compared with controls, and in Alzheimer's dementia and progressive MCI compared with stable MCI.
26366630 Within-person levels of NGRN increased in cognitively normal participants but not in patients with later stage mild cognitive impairment or Alzhiemer's disease; NGRN may reflect presymptomatic synaptic dysfunction or loss.
26025774 This report provides evidence to support larger and controlled traumatic brain injury clinical studies for NRGN validation and prediction of outcomes.
25446004 neurogranin binds to alpha-synuclein in the human cortex, and this interaction decreases in Parkinson's disease along with the phosphorylation of neurogranin, a molecular process thought to be involved in learning and memory
24713697 Data indicate that neurogranin makes contacts with both the N- and C-domains of calmodulin that functionally leads to altered calcium binding kinetics.
24386483 These findings help to clarify underlying NRGN mediated pathophysiological mechanisms involving cortical-subcortical brain networks in schizophrenia.
24098564 NRGN risk variants contribute to subtle changes in neural functioning and anatomy.
More...

AA Sequence

MDCCTENACSKPDDDILDIPLDDPGANAAAAKIQASFRGHMARKKIKSGERGRKGPGPGGPGGAGVARGG      1 - 70
AGGGPSGD                                                                   71 - 78
//

Text Mined References (44)

PMID Year Title
26828755 2016 Polymorphisms in NRGN are associated with schizophrenia, major depressive disorder and bipolar disorder in the Han Chinese population.
26826204 2016 Increased CSF neurogranin concentration is specific to Alzheimer disease.
26698298 2015 Neurogranin and YKL-40: independent markers of synaptic degeneration and neuroinflammation in Alzheimer's disease.
26373605 2015 Cerebrospinal fluid neurogranin: relation to cognition and neurodegeneration in Alzheimer's disease.
26366630 2015 Neurogranin as a Cerebrospinal Fluid Biomarker for Synaptic Loss in Symptomatic Alzheimer Disease.
26025774 2015 Serum neurogranin measurement as a biomarker of acute traumatic brain injury.
25446004 2014 Neurogranin binds ?-synuclein in the human superior temporal cortex and interaction is decreased in Parkinson's disease.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24713697 2014 Neurogranin alters the structure and calcium binding properties of calmodulin.
24386483 2013 Effects of the neurogranin variant rs12807809 on thalamocortical morphology in schizophrenia.
More...