Property Summary

NCBI Gene PubMed Count 12
PubMed Score 34.27
PubTator Score 17.21

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
non-small cell lung cancer 2798 2.37437717994813E-24
lung adenocarcinoma 2714 4.96007720916507E-12
malignant mesothelioma 3163 6.04343118727579E-6
medulloblastoma, large-cell 6234 3.57906679208502E-4
inflammatory breast cancer 404 0.00278864881537433
Disease Target Count Z-score Confidence
Congenital disorder of glycosylation 53 4.88 2.4
Disease Target Count Z-score Confidence
Microcephaly 149 3.807 1.9
Disease Target Count
ALG3-CDG 1

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
medulloblastoma, large-cell 1.200 0.000
non-small cell lung cancer 1.398 0.000
lung adenocarcinoma 1.200 0.000
inflammatory breast cancer 1.300 0.003

Synonym

Accession Q92685 A8JZZ6 Q9BT71
Symbols not
CDG1D
CDGS4
CDGS6
Not56
NOT56L
D16Ertd36e

Gene

PANTHER Protein Class (2)

  Ortholog (9)

Species Source
Macaque EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
23791010 ALG3-CDG is due to an autosomal recessive defect in the ER mannosyl-transferase VI, which is involved in protein N-glycosylation. The enzyme is encoded by the ALG3 gene
16006436 a mutation in ALG3 affects splicing and may have a role in development of congenital disorder of glycosylation type Id [case report]

AA Sequence

MAAGLRKRGRSGSAAQAEGLCKQWLQRAWQERRLLLREPRYTLLVAACLCLAEVGITFWVIHRVAYTEID      1 - 70
WKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIRMAQNIFAVLYLATLLLVF     71 - 140
LIYHQTCKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMVLLFLSINLLLAQRWGWGCCFFSLAVSVKMN    141 - 210
VLLFAPGLLFLLLTQFGFRGALPKLGICAGLQVVLGLPFLLENPSGYLSRSFDLGRQFLFHWTVNWRFLP    211 - 280
EALFLHRAFHLALLTAHLTLLLLFALCRWHRTGESILSLLRDPSKRKVPPQPLTPNQIVSTLFTSNFIGI    281 - 350
CFSRSLHYQFYVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSCSSAALHICHAVILLQL    351 - 420
WLGPQPFPKSTQHSKKAH                                                        421 - 438
//

Text Mined References (19)

PMID Year Title
23791010 ALG3-CDG (CDG-Id): clinical, biochemical and molecular findings in two siblings.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22472876 2013 A mega-analysis of genome-wide association studies for major depressive disorder.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16006436 2005 Congenital disorder of glycosylation type Id: clinical phenotype, molecular analysis, prenatal diagnosis, and glycosylation of fetal proteins.
15840742 2005 Congenital disorder of glycosylation id presenting with hyperinsulinemic hypoglycemia and islet cell hyperplasia.
More...