Property Summary

NCBI Gene PubMed Count 12
Grant Count 10
R01 Count 10
Funding $1,298,903.5
PubMed Score 34.27
PubTator Score 17.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
medulloblastoma, large-cell 1.200 0.000
non-small cell lung cancer 1.398 0.000
lung adenocarcinoma 1.200 0.000
inflammatory breast cancer 1.300 0.003

Gene RIF (2)

PMID Text
23791010 ALG3-CDG is due to an autosomal recessive defect in the ER mannosyl-transferase VI, which is involved in protein N-glycosylation. The enzyme is encoded by the ALG3 gene
16006436 a mutation in ALG3 affects splicing and may have a role in development of congenital disorder of glycosylation type Id [case report]

AA Sequence

MAAGLRKRGRSGSAAQAEGLCKQWLQRAWQERRLLLREPRYTLLVAACLCLAEVGITFWVIHRVAYTEID      1 - 70
WKAYMAEVEGVINGTYDYTQLQGDTGPLVYPAGFVYIFMGLYYATSRGTDIRMAQNIFAVLYLATLLLVF     71 - 140
LIYHQTCKVPPFVFFFMCCASYRVHSIFVLRLFNDPVAMVLLFLSINLLLAQRWGWGCCFFSLAVSVKMN    141 - 210
VLLFAPGLLFLLLTQFGFRGALPKLGICAGLQVVLGLPFLLENPSGYLSRSFDLGRQFLFHWTVNWRFLP    211 - 280
EALFLHRAFHLALLTAHLTLLLLFALCRWHRTGESILSLLRDPSKRKVPPQPLTPNQIVSTLFTSNFIGI    281 - 350
CFSRSLHYQFYVWYFHTLPYLLWAMPARWLTHLLRLLVLGLIELSWNTYPSTSCSSAALHICHAVILLQL    351 - 420
WLGPQPFPKSTQHSKKAH                                                        421 - 438
//

Text Mined References (19)

PMID Year Title
23791010 ALG3-CDG (CDG-Id): clinical, biochemical and molecular findings in two siblings.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22472876 2013 A mega-analysis of genome-wide association studies for major depressive disorder.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
18691976 2008 Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
16641997 2006 The DNA sequence, annotation and analysis of human chromosome 3.
16006436 2005 Congenital disorder of glycosylation type Id: clinical phenotype, molecular analysis, prenatal diagnosis, and glycosylation of fetal proteins.
15840742 2005 Congenital disorder of glycosylation id presenting with hyperinsulinemic hypoglycemia and islet cell hyperplasia.
More...