Property Summary

NCBI Gene PubMed Count 13
PubMed Score 4.61
PubTator Score 2.83

Knowledge Summary

Patent

No data available

Synonym

Accession Q92681 B2RBP5
Symbols RS1

Gene

PANTHER Protein Class (2)

Gene RIF (5)

PMID Text
20800603 Observational study of gene-disease association. (HuGE Navigator)
17686765 RSC1A1 codes for a 67-kDa protein named RS1 that mediates transcriptional and post-transcriptional regulation of Na(+)-D-glucose cotransporter SGLT1.
16788147 RS1 inhibits the dynamin-dependent release of SGLT1-containing vesicles from the trans-golgi network
16788146 hRS1 protein exhibits glucose-dependent, short-term inhibition of hSGLT1 and hOCT2 by inhibiting the release of vesicles from the trans-Golgi network
14724758 Taken together, these data indicate that RSC1A1 modulates dynamin-dependent trafficking of intracellular vesicles containing hSGLT1 in Xenopus oocytes, and modulates PKC-dependent short-term regulation of this transporter.

AA Sequence

MSSLPTSDGFNHPARSSGQSPDVGNPMSLARSVSASVCPIKPSDSDRIEPKAVKALKASAEFQLNSEKKE      1 - 70
HLSLQDLSDHASSADHAPTDQSPAMPMQNSSEEITVAGNLEKSAERSTQGLKFHLHTRQEASLSVTSTRM     71 - 140
HEPQMFLGEKDWHPENQNLSQVSDPQQHEEPGNEQYEVAQQKASHDQEYLCNIGDLELPEERQQNQHKIV    141 - 210
DLEATMKGNGLPQNVDPPSAKKSIPSSECSGCSNSETFMEIDTAQQSLVTLLNSTGRQNANVKNIGALDL    211 - 280
TLDNPLMEVETSKCNPSSEILNDSISTQDLQPPETNVEIPGTNKEYGHYSSPSLCGSCQPSVESAEESCP    281 - 350
SITAALKELHELLVVSSKPASENTSEEVICQSETIAEGQTSIKDLSERWTQNEHLTQNEQCPQVSFHQAI    351 - 420
SVSVETEKLTGTSSDTGREAVENVNFRSLGDGLSTDKEGVPKSRESINKNRSVTVTSAKTSNQLHCTLGV    421 - 490
EISPKLLAGEEDALNQTSEQTKSLSSNFILVKDLGQGIQNSVTDRPETRENVCPDASRPLLEYEPPTSHP    491 - 560
SSSPAILPPLIFPATDIDRILRAGFTLQEALGALHRVGGNADLALLVLLAKNIVVPT                 561 - 617
//

Text Mined References (14)

PMID Year Title
26464324 2016 Phosphorylation of RS1 (RSC1A1) Steers Inhibition of Different Exocytotic Pathways for Glucose Transporter SGLT1 and Nucleoside Transporter CNT1, and an RS1-Derived Peptide Inhibits Glucose Absorption.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19765263 2009 Novel shuttling domain in a regulator (RSC1A1) of transporter SGLT1 steers cell cycle-dependent nuclear location.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17686765 2007 Tripeptides of RS1 (RSC1A1) inhibit a monosaccharide-dependent exocytotic pathway of Na+-D-glucose cotransporter SGLT1 with high affinity.
16788147 2006 Transporter regulator RS1 (RSC1A1) coats the trans-Golgi network and migrates into the nucleus.
16788146 2006 RS1 (RSC1A1) regulates the exocytotic pathway of Na+-D-glucose cotransporter SGLT1.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
14724758 2003 Downregulation of the Na(+)- D-glucose cotransporter SGLT1 by protein RS1 (RSC1A1) is dependent on dynamin and protein kinase C.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...