Property Summary

NCBI Gene PubMed Count 19
PubMed Score 26.56
PubTator Score 9.80

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
psoriasis 6685 9.28829084390207E-60
non-small cell lung cancer 2798 2.26467710632147E-16
Breast cancer 3099 2.12023633532206E-10
lung adenocarcinoma 2714 4.96991753365074E-8
atypical teratoid/rhabdoid tumor 1095 4.38848394563165E-7
malignant mesothelioma 3163 1.39856891508614E-6
group 3 medulloblastoma 2254 3.43357569136647E-5
lung cancer 4473 1.21002698170096E-4
glioblastoma 5572 3.14952434875978E-4
medulloblastoma, large-cell 6234 0.001155976859429
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00291235286633057
adrenocortical carcinoma 1427 0.0118488711268731
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0119225960034079
colon cancer 1475 0.0470922933589105

Expression

Synonym

Accession Q92674 Q5JWZ9 Q96ED0 CENP-I
Symbols LRPR1
CENP-I
FSHPRH1

Gene

  Ortholog (14)

Gene RIF (6)

PMID Text
26527398 CENP-C and CENP-I are key factors connecting kinetochore to CENP-A assembly.
25525168 mutation in LRPAP1 is associated with high myopia. Further studies are expected to evaluate the pathogenicity of the variants in CTSH, LEPREL1, ZNF644, SLC39A5, and SCO2.
24862574 We conclude that the dual activities of Aurora B and CENP-I generate a molecular switch that maintains a robust spindle checkpoint signal at prometaphase kinetochores until they attain mature attachments to microtubules.
21888900 demonstrates that CENPI, a centromere protein that localizes to the inner kinetochore structure, is a human autoantigen. The significance of anti-CENPI autoantibodies could be relevant in scleroderma patients as a marker for autoimmune liver disease
18045986 the vertebrate KNL1 counterpart is essential for chromosome segregation and is required to localize a subset of outer kinetochore proteins.
16622420 The CENP-H-I complex may function, in part, as a marker directing CENP-A deposition to centromeres.

AA Sequence

MSPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPVGDYEHADDQAEEDALQMAV      1 - 70
GYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVNTRILKCMIPATVIS     71 - 140
EDSVVKAVSWLCVGKCSGSTKVLFYRWLVAMFDFIDRKEQINLLYGFFFASLQDDALCPYVCHLLYLLTK    141 - 210
KENVKPFRVRKLLDLQAKMGMQPHLQALLSLYKFFAPALISVSLPVRKKIYFKNSENLWKTALLAVKQRN    211 - 280
RGPSPEPLKLMLGPANVRPLKRKWNSLSVIPVLNSSSYTKECGKKEMSLSDCLNRSGSFPLEQLQSFPQL    281 - 350
LQNIHCLELPSQMGSVLNNSLLLHYINCVRDEPVLLRFYYWLSQTLQEECIWYKVNNYEHGKEFTNFLDT    351 - 420
IIRAECFLQEGFYSCEAFLYKSLPLWDGLCCRSQFLQLVSWIPFSSFSEVKPLLFDHLAQLFFTSTIYFK    421 - 490
CSVLQSLKELLQNWLLWLSMDIHMKPVTNSPLETTLGGSMNSVSKLIHYVGWLSTTAMRLESNNTFLLHF    491 - 560
ILDFYEKVCDIYINYNLPLVVLFPPGIFYSALLSLDTSILNQLCFIMHRYRKNLTAAKKNELVQKTKSEF    561 - 630
NFSSKTYQEFNHYLTSMVGCLWTSKPFGKGIYIDPEILEKTGVAEYKNSLNVVHHPSFLSYAVSFLLQES    631 - 700
PEERTVNVSSIRGKKWSWYLDYLFSQGLQGLKLFIRSSVHHSSIPRAEGINCNNQY                  701 - 756
//

Text Mined References (20)

PMID Year Title
26527398 2015 CENP-C and CENP-I are key connecting factors for kinetochore and CENP-A assembly.
25525168 2014 Detection of mutations in LRPAP1, CTSH, LEPREL1, ZNF644, SLC39A5, and SCO2 in 298 families with early-onset high myopia by exome sequencing.
24862574 2014 CENP-I and Aurora B act as a molecular switch that ties RZZ/Mad1 recruitment to kinetochore attachment status.
21888900 2011 Anti-CENPI autoantibodies in scleroderma patients with features of autoimmune liver diseases.
20212317 2010 The SUMO protease SENP6 is essential for inner kinetochore assembly.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18045986 2008 KNL1 and the CENP-H/I/K complex coordinately direct kinetochore assembly in vertebrates.
16716197 2006 Comprehensive analysis of the ICEN (Interphase Centromere Complex) components enriched in the CENP-A chromatin of human cells.
16622420 2006 The CENP-H-I complex is required for the efficient incorporation of newly synthesized CENP-A into centromeres.
16622419 2006 The human CENP-A centromeric nucleosome-associated complex.
More...