Property Summary

NCBI Gene PubMed Count 19
PubMed Score 30.48
PubTator Score 9.80

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adrenocortical carcinoma 1.211 1.2e-02
atypical teratoid / rhabdoid tumor 1.200 4.9e-05
Breast cancer 1.400 2.1e-10
colon cancer 1.800 4.7e-02
glioblastoma 1.100 3.1e-04
group 3 medulloblastoma 1.200 2.0e-04
intraductal papillary-mucinous carcinoma... 1.100 1.2e-02
intraductal papillary-mucinous neoplasm ... 1.300 2.9e-03
lung adenocarcinoma 1.300 5.0e-08
lung cancer 1.700 1.6e-02
malignant mesothelioma 1.200 3.0e-06
medulloblastoma, large-cell 1.100 1.3e-04
non-small cell lung cancer 1.473 2.3e-16
psoriasis 1.200 9.3e-60

Synonym

Accession Q92674 Q5JWZ9 Q96ED0 CENP-I
Symbols LRPR1
CENP-I
FSHPRH1

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (6)

AA Sequence

MSPQKRVKNVQAQNRTSQGSSSFQTTLSAWKVKQDPSNSKNISKHGQNNPVGDYEHADDQAEEDALQMAV      1 - 70
GYFEKGPIKASQNKDKTLEKHLKTVENVAWKNGLASEEIDILLNIALSGKFGNAVNTRILKCMIPATVIS     71 - 140
EDSVVKAVSWLCVGKCSGSTKVLFYRWLVAMFDFIDRKEQINLLYGFFFASLQDDALCPYVCHLLYLLTK    141 - 210
KENVKPFRVRKLLDLQAKMGMQPHLQALLSLYKFFAPALISVSLPVRKKIYFKNSENLWKTALLAVKQRN    211 - 280
RGPSPEPLKLMLGPANVRPLKRKWNSLSVIPVLNSSSYTKECGKKEMSLSDCLNRSGSFPLEQLQSFPQL    281 - 350
LQNIHCLELPSQMGSVLNNSLLLHYINCVRDEPVLLRFYYWLSQTLQEECIWYKVNNYEHGKEFTNFLDT    351 - 420
IIRAECFLQEGFYSCEAFLYKSLPLWDGLCCRSQFLQLVSWIPFSSFSEVKPLLFDHLAQLFFTSTIYFK    421 - 490
CSVLQSLKELLQNWLLWLSMDIHMKPVTNSPLETTLGGSMNSVSKLIHYVGWLSTTAMRLESNNTFLLHF    491 - 560
ILDFYEKVCDIYINYNLPLVVLFPPGIFYSALLSLDTSILNQLCFIMHRYRKNLTAAKKNELVQKTKSEF    561 - 630
NFSSKTYQEFNHYLTSMVGCLWTSKPFGKGIYIDPEILEKTGVAEYKNSLNVVHHPSFLSYAVSFLLQES    631 - 700
PEERTVNVSSIRGKKWSWYLDYLFSQGLQGLKLFIRSSVHHSSIPRAEGINCNNQY                  701 - 756
//

Text Mined References (20)

PMID Year Title