Property Summary

NCBI Gene PubMed Count 150
PubMed Score 188.36
PubTator Score 183.23

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (24)

Disease log2 FC p
astrocytic glioma 1.600 8.7e-03
atypical teratoid / rhabdoid tumor -2.200 1.4e-05
Breast cancer -1.300 5.0e-05
Chronic Lymphocytic Leukemia -1.810 7.6e-04
dermatomyositis 1.200 1.5e-02
glioblastoma -1.100 2.9e-04
group 3 medulloblastoma -3.700 1.8e-10
interstitial cystitis -1.800 7.9e-04
intraductal papillary-mucinous adenoma (... 1.600 4.3e-03
intraductal papillary-mucinous carcinoma... 1.100 3.2e-02
invasive ductal carcinoma 1.320 4.5e-04
lung cancer -1.400 1.8e-03
lung carcinoma 1.100 3.7e-14
malignant mesothelioma 3.000 2.3e-07
medulloblastoma, large-cell -3.200 4.3e-08
oligodendroglioma 1.500 8.6e-03
osteosarcoma -2.740 1.0e-02
ovarian cancer 1.500 4.0e-04
pancreatic cancer 1.100 9.7e-03
pancreatic ductal adenocarcinoma liver m... 1.002 8.5e-03
posterior fossa group A ependymoma -1.100 2.1e-06
primitive neuroectodermal tumor -1.200 2.5e-04
psoriasis -1.600 1.2e-08
Waldenstrons macroglobulinemia 1.348 4.0e-02

Protein-protein Interaction (1)

Gene RIF (147)

AA Sequence

MATRSSRRESRLPFLFTLVALLPPGALCEVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGAS      1 - 70
RADEKPLRRKRSAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYD     71 - 140
YGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPFRAADLL    141 - 210
LHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRS    211 - 280
TDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSVQLWVSFGRKPMRAAQFVTRHPINEYY    281 - 350
IADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGL    351 - 420
QGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLR    421 - 490
RMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNE    491 - 560
LKYSTNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDY    561 - 630
KLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCV    631 - 700
PDPEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAVRKSIY    701 - 770
RYDLASGATEQLPLTGLRAAVALDFDYEHNCLYWSDLALDVIQRLCLNGSTGQEVIINSGLETVEALAFE    771 - 840
PLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYRSNMDGS    841 - 910
AAYHLVSEDVKWPNGISVDDQWIYWTDAYLECIERITFSGQQRSVILDNLPHPYAIAVFKNEIYWDDWSQ    911 - 980
LSIFRASKYSGSQMEILANQLTGLMDMKIFYKGKNTGSNACVPRPCSLLCLPKANNSRSCRCPEDVSSSV    981 - 1050
LPSGDLMCDCPQGYQLKNNTCVKQENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLD   1051 - 1120
TQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEA   1121 - 1190
NCTAIYHTCEASNFQCRNGHCIPQRWACDGDTDCQDGSDEDPVNCEKKCNGFRCPNGTCIPSSKHCDGLR   1191 - 1260
DCSDGSDEQHCEPLCTHFMDFVCKNRQQCLFHSMVCDGIIQCRDGSDEDAAFAGCSQDPEFHKVCDEFGF   1261 - 1330
QCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSDE   1331 - 1400
KDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAASTPTQLGR   1401 - 1470
CDRFEFECHQPKTCIPNWKRCDGHQDCQDGRDEANCPTHSTLTCMSREFQCEDGEACIVLSERCDGFLDC   1471 - 1540
SDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKT   1541 - 1610
NTVLKVLKPDTTYQVKVQVQCLSKAHNTNDFVTLRTPEGLPDAPRNLQLSLPREAEGVIVGHWAPPIHTH   1611 - 1680
GLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLVNTLYTVRVAAVTSRGIGNWSDSKSITTIKGKVIPP   1681 - 1750
PDIHIDSYGENYLSFTLTMESDIKVNGYVVNLFWAFDTHKQERRTLNFRGSILSHKVGNLTAHTSYEISA   1751 - 1820
WAKTDLGDSPLAFEHVMTRGVRPPAPSLKAKAINQTAVECTWTGPRNVVYGIFYATSFLDLYRNPKSLTT   1821 - 1890
SLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPD   1891 - 1960
QDLLYAVAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDAL   1961 - 2030
KIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQAR   2031 - 2100
CLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFT   2101 - 2170
AFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA                             2171 - 2214
//

Text Mined References (157)

PMID Year Title