Property Summary

NCBI Gene PubMed Count 127
Grant Count 61
R01 Count 21
Funding $15,927,417.65
PubMed Score 197.02
PubTator Score 183.23

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92673 B2RNX7 Q92856
Symbols LR11
LRP9
SORLA
gp250
SorLA-1
C11orf32

Gene

PANTHER Protein Class (1)

PDB

3G2S   3G2T   2DM4   3WSX   3WSY   3WSZ  

Gene RIF (125)

PMID Text
26858303 CLF-1, based on its binding site for CLC and on two additional and independent sites for CNTFRalpha and sorLA, is a key player in CLC and CNTFRalpha signaling and turnover.
26584636 sLR11 levels in humans are shown to positively correlate with body mass index and adiposity.
26520897 Elevated sLR11 levels may increase the cardiovascular disease risk especially in subjects with delayed clearance of triglyceride-rich remnants, such as in familial hypercholesterolemia patients.
26377460 Mutating recombinant human SORLA, disrupting retromer binding caused retrograde-sorting defect, endosomal accumulation, TGN, depletion, and enhanced APP processing. Disrupting the GGA interaction increased Abeta via defective anterograde lysosomal targeting.
25881907 The findings of this study confirm that SORL1 is associated with Alzheimer's Disease and might be a potential tool for identifying Mild Cognitive Impairment subjects at high risk of conversion to lzheimer's Disease.
25835329 Mutants of metal binding site M1 in APP E2 show metal specific differences in binding of heparin but not of sorLA
25772071 genetic polymorphism controls protein expression, which directly regulates the amount of Abeta peptides implicated in Alzheimer's disease
25676033 Serum soluble LR11, a novel tumor derived biomarker associated with the outcome of patients with diffuse large B-cell lymphoma
25659857 SORL1 may be implicated in the downstream pathology in AD.
25598427 Study suggested a sex-moderated association of the SORL1 rs2070045 polymorphism and executive function in healthy elderly
More...

AA Sequence

MATRSSRRESRLPFLFTLVALLPPGALCEVWTQRLHGGSAPLPQDRGFLVVQGDPRELRLWARGDARGAS      1 - 70
RADEKPLRRKRSAALQPEPIKVYGQVSLNDSHNQMVVHWAGEKSNVIVALARDSLALARPKSSDVYVSYD     71 - 140
YGKSFKKISDKLNFGLGNRSEAVIAQFYHSPADNKRYIFADAYAQYLWITFDFCNTLQGFSIPFRAADLL    141 - 210
LHSKASNLLLGFDRSHPNKQLWKSDDFGQTWIMIQEHVKSFSWGIDPYDKPNTIYIERHEPSGYSTVFRS    211 - 280
TDFFQSRENQEVILEEVRDFQLRDKYMFATKVVHLLGSEQQSSVQLWVSFGRKPMRAAQFVTRHPINEYY    281 - 350
IADASEDQVFVCVSHSNNRTNLYISEAEGLKFSLSLENVLYYSPGGAGSDTLVRYFANEPFADFHRVEGL    351 - 420
QGVYIATLINGSMNEENMRSVITFDKGGTWEFLQAPAFTGYGEKINCELSQGCSLHLAQRLSQLLNLQLR    421 - 490
RMPILSKESAPGLIIATGSVGKNLASKTNVYISSSAGARWREALPGPHYYTWGDHGGIITAIAQGMETNE    491 - 560
LKYSTNEGETWKTFIFSEKPVFVYGLLTEPGEKSTVFTIFGSNKENVHSWLILQVNATDALGVPCTENDY    561 - 630
KLWSPSDERGNECLLGHKTVFKRRTPHATCFNGEDFDRPVVVSNCSCTREDYECDFGFKMSEDLSLEVCV    631 - 700
PDPEFSGKSYSPPVPCPVGSTYRRTRGYRKISGDTCSGGDVEARLEGELVPCPLAEENEFILYAVRKSIY    701 - 770
RYDLASGATEQLPLTGLRAAVALDFDYEHNCLYWSDLALDVIQRLCLNGSTGQEVIINSGLETVEALAFE    771 - 840
PLSQLLYWVDAGFKKIEVANPDGDFRLTIVNSSVLDRPRALVLVPQEGVMFWTDWGDLKPGIYRSNMDGS    841 - 910
AAYHLVSEDVKWPNGISVDDQWIYWTDAYLECIERITFSGQQRSVILDNLPHPYAIAVFKNEIYWDDWSQ    911 - 980
LSIFRASKYSGSQMEILANQLTGLMDMKIFYKGKNTGSNACVPRPCSLLCLPKANNSRSCRCPEDVSSSV    981 - 1050
LPSGDLMCDCPQGYQLKNNTCVKQENTCLRNQYRCSNGNCINSIWWCDFDNDCGDMSDERNCPTTICDLD   1051 - 1120
TQFRCQESGTCIPLSYKCDLEDDCGDNSDESHCEMHQCRSDEYNCSSGMCIRSSWVCDGDNDCRDWSDEA   1121 - 1190
NCTAIYHTCEASNFQCRNGHCIPQRWACDGDTDCQDGSDEDPVNCEKKCNGFRCPNGTCIPSSKHCDGLR   1191 - 1260
DCSDGSDEQHCEPLCTHFMDFVCKNRQQCLFHSMVCDGIIQCRDGSDEDAAFAGCSQDPEFHKVCDEFGF   1261 - 1330
QCQNGVCISLIWKCDGMDDCGDYSDEANCENPTEAPNCSRYFQFRCENGHCIPNRWKCDRENDCGDWSDE   1331 - 1400
KDCGDSHILPFSTPGPSTCLPNYYRCSSGTCVMDTWVCDGYRDCADGSDEEACPLLANVTAASTPTQLGR   1401 - 1470
CDRFEFECHQPKTCIPNWKRCDGHQDCQDGRDEANCPTHSTLTCMSREFQCEDGEACIVLSERCDGFLDC   1471 - 1540
SDESDEKACSDELTVYKVQNLQWTADFSGDVTLTWMRPKKMPSASCVYNVYYRVVGESIWKTLETHSNKT   1541 - 1610
NTVLKVLKPDTTYQVKVQVQCLSKAHNTNDFVTLRTPEGLPDAPRNLQLSLPREAEGVIVGHWAPPIHTH   1611 - 1680
GLIREYIVEYSRSGSKMWASQRAASNFTEIKNLLVNTLYTVRVAAVTSRGIGNWSDSKSITTIKGKVIPP   1681 - 1750
PDIHIDSYGENYLSFTLTMESDIKVNGYVVNLFWAFDTHKQERRTLNFRGSILSHKVGNLTAHTSYEISA   1751 - 1820
WAKTDLGDSPLAFEHVMTRGVRPPAPSLKAKAINQTAVECTWTGPRNVVYGIFYATSFLDLYRNPKSLTT   1821 - 1890
SLHNKTVIVSKDEQYLFLVRVVVPYQGPSSDYVVVKMIPDSRLPPRHLHVVHTGKTSVVIKWESPYDSPD   1891 - 1960
QDLLYAVAVKDLIRKTDRSYKVKSRNSTVEYTLNKLEPGGKYHIIVQLGNMSKDSSIKITTVSLSAPDAL   1961 - 2030
KIITENDHVLLFWKSLALKEKHFNESRGYEIHMFDSAMNITAYLGNTTDNFFKISNLKMGHNYTFTVQAR   2031 - 2100
CLFGNQICGEPAILLYDELGSGADASATQAARSTDVAAVVVPILFLILLSLGVGFAILYTKHRRLQSSFT   2101 - 2170
AFANSHYSSRLGSAIFSSGDDLGEDDEDAPMITGFSDDVPMVIA                             2171 - 2214
//

Text Mined References (134)

PMID Year Title
26858303 2016 Cytokine-Like Factor 1, an Essential Facilitator of Cardiotrophin-Like Cytokine:Ciliary Neurotrophic Factor Receptor ? Signaling and sorLA-Mediated Turnover.
26584636 2015 Soluble LR11/SorLA represses thermogenesis in adipose tissue and correlates with BMI in humans.
26520897 2015 LR11/SorLA links triglyceride-rich lipoproteins to risk of developing cardiovascular disease in FH patients.
26377460 2015 Distinct Functions for Anterograde and Retrograde Sorting of SORLA in Amyloidogenic Processes in the Brain.
25881907 2015 SORL1 Gene is Associated with the Conversion from Mild Cognitive Impairment to Alzheimer's Disease.
25835329 2015 Mutants of metal binding site M1 in APP E2 show metal specific differences in binding of heparin but not of sorLA.
25772071 2015 Elucidating molecular phenotypes caused by the SORL1 Alzheimer's disease genetic risk factor using human induced pluripotent stem cells.
25676033 2015 Serum soluble LR11, a novel tumor derived biomarker associated with the outcome of patients with diffuse large B-cell lymphoma.
25659857 2015 Influence of genetic variants in SORL1 gene on the manifestation of Alzheimer's disease.
25598427 2015 Sex moderates the effects of the Sorl1 gene rs2070045 polymorphism on cognitive impairment and disruption of the cingulum integrity in healthy elderly.
More...