Property Summary

NCBI Gene PubMed Count 2
PubMed Score 0.00
PubTator Score 0.25

Knowledge Summary

Patent

No data available

AA Sequence

MIMRELKADACLNSHMGAMWETNRSVKENSSQSKKYSTQIECLSPGSACRHFRSFHYHEATEPLEAINQL      1 - 70
QKLCHQWLRPEIHSKKHILEMLVLEHFLTILPKGTQNWVQKHHPQLAKQALVLVERLQREPGGTKNEVTA     71 - 140
HELGEEAVLLRGTTVAPGFKWKPAELEPMERILEHIQILALSEHKSTKDWKMAPKLIWPESQSLLTFEDM    141 - 210
AVYFSEEEWQLLGPLEKTLYNDVMQDIYETAISLGKQRTGKIMGIEMASSFSKEEKKLTTCKQELPKLMD    211 - 280
LHGKGHTGEKPFKCQDCGKIFRVSSDLIKHQRIHTEEKLYKCQQCDRRFRWSSGLNKHFMTHQGINPYRC    281 - 350
SWYGKSISYDTNLQTHQRIHTGEKPFKCHECGKIFIHKSNLIKYQRTHTGEQPYTCSICRRNFSRQLSLL    351 - 420
RHQKLH                                                                    421 - 426
//

Text Mined References (2)

PMID Year Title
16554811 2006 Human chromosome 11 DNA sequence and analysis including novel gene identification.
8661144 1996 The ZNF75 zinc finger gene subfamily: isolation and mapping of the four members in humans and great apes.