Property Summary

NCBI Gene PubMed Count 41
Grant Count 313
R01 Count 183
Funding $29,742,884.73
PubMed Score 181.16
PubTator Score 148.38

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92667 A8K8Q1 D3DTZ0 Q13320 Q9BW14
Symbols AKAP
PRKA1
AKAP84
TDRD17
AKAP121
AKAP149
D-AKAP1
PPP1R43
SAKAP84

Gene

PANTHER Protein Class (2)

Gene RIF (18)

PMID Text
26437602 Functional characterization revealed an undescribed role for AMPK-dependent phosphorylation of AKAP1 in mitochondrial respiration.
24813785 AKAP 149-PKA-PDE4A complex localization is related with YTX effect in K-562 cell line
23557075 In the case of the beta2AR, this process is facilitated by the presence of A-Kinase Anchoring Proteins (AKAPs) that serve as scaffolding proteins for the L-type calcium channel and the beta2AR complex.
23077346 AKAP1 anchors Star mRNA at the mitochondria, thus stabilizing the translational complex at this organelle, a situation that might affect STAR production and steroidogenesis.
23045525 Shp2 is a component of the AKAP-Lbc complex and is inhibited by protein kinase A under pathological hypertrophic conditions in the heart.
22807343 In tumoural lymphocytes, yessotoxin decreases AKAP149 cytosolic expression and increases cAMP levels which leads to cell death.
21994574 AKAP149 is an HIV-1 RT binding protein. Amino acids 375-645 of APAK149 and amino acids 464-541 of HIV-1 RT p66 are involved in the binding between APAK149 and RT p66. A single-point mutant RT G462R fails to carry out reverse transcription
20877624 Observational study of gene-disease association. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
19750561 AKAP149 is an HIV-1 RT binding protein. Amino acids 375-645 of APAK149 and amino acids 464-541 of HIV-1 RT p66 are involved in the binding between APAK149 and RT p66. A single-point mutant RT G462R fails to carry out reverse transcription
More...

AA Sequence

MAIQFRSLFPLALPGMLALLGWWWFFSRKKGHVSSHDEQQVEAGAVQLRADPAIKEPLPVEDVCPKVVST      1 - 70
PPSVTEPPEKELSTVSKLPAEPPALLQTHPPCRRSESSGILPNTTDMRLRPGTRRDDSTKLELALTGGEA     71 - 140
KSIPLECPLSSPKGVLFSSKSAEVCKQDSPFSRVPRKVQPGYPVVPAEKRSSGERARETGGAEGTGDAVL    141 - 210
GEKVLEEALLSREHVLELENSKGPSLASLEGEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELA    211 - 280
KDDAAPAPPVADAKAQDRGVEGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQ    281 - 350
IISQVISEATEQVLATTVGKVAGRVCQASQLQGQKEESCVPVHQKTVLGPDTAEPATAEAAVAPPDAGLP    351 - 420
LPGLPAEGSPPPKTYVSCLKSLLSSPTKDSKPNISAHHISLASCLALTTPSEELPDRAGILVEDATCVTC    421 - 490
MSDSSQSVPLVASPGHCSDSFSTSGLEDSCTETSSSPRDKAITPPLPESTVPFSNGVLKGELSDLGAEDG    491 - 560
WTMDAEADHSGGSDRNSMDSVDSCCSLKKTESFQNAQAGSNPKKVDLIIWEIEVPKHLVGRLIGKQGRYV    561 - 630
SFLKQTSGAKIYISTLPYTQSVQICHIEGSQHHVDKALNLIGKKFKELNLTNIYAPPLPSLALPSLPMTS    631 - 700
WLMLPDGITVEVIVVNQVNAGHLFVQQHTHPTFHALRSLDQQMYLCYSQPGIPTLPTPVEITVICAAPGA    701 - 770
DGAWWRAQVVASYEETNEVEIRYVDYGGYKRVKVDVLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSP    771 - 840
EADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYYTSL           841 - 903
//

Text Mined References (51)

PMID Year Title
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26437602 2015 Global Phosphoproteomic Analysis of Human Skeletal Muscle Reveals a Network of Exercise-Regulated Kinases and AMPK Substrates.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24813785 2014 Role of AKAP 149-PKA-PDE4A complex in cell survival and cell differentiation processes.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24083380 2013 Differential PKA activation and AKAP association determines cell fate in cancer cells.
23557075 2013 A macromolecular trafficking complex composed of ??-adrenergic receptors, A-Kinase Anchoring Proteins and L-type calcium channels.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23077346 2012 Short RNA molecules with high binding affinity to the KH motif of A-kinase anchoring protein 1 (AKAP1): implications for the regulation of steroidogenesis.
23045525 2012 Src homology 2 domain-containing phosphatase 2 (Shp2) is a component of the A-kinase-anchoring protein (AKAP)-Lbc complex and is inhibited by protein kinase A (PKA) under pathological hypertrophic conditions in the heart.
More...