Property Summary

NCBI Gene PubMed Count 15
PubMed Score 204.73
PubTator Score 65.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
acute quadriplegic myopathy 1.058 1.0e-05
colon cancer 1.400 5.5e-03
intraductal papillary-mucinous adenoma (... 1.600 1.8e-03
intraductal papillary-mucinous carcinoma... 1.600 9.1e-03
lung cancer 1.300 9.7e-03
osteosarcoma 2.292 9.5e-05
ovarian cancer -2.000 4.5e-11
psoriasis 1.100 3.7e-04

AA Sequence

MDPPAVVAESVSSLTIADAFIAAGESSAPTPPRPALPRRFICSFPDCSANYSKAWKLDAHLCKHTGERPF      1 - 70
VCDYEGCGKAFIRDYHLSRHILTHTGEKPFVCAANGCDQKFNTKSNLKKHFERKHENQQKQYICSFEDCK     71 - 140
KTFKKHQQLKIHQCQHTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVR    141 - 210
ETHKEEILCEVCRKTFKRKDYLKQHMKTHAPERDVCRCPREGCGRTYTTVFNLQSHILSFHEESRPFVCE    211 - 280
HAGCGKTFAMKQSLTRHAVVHDPDKKKMKLKVKKSREKRSLASHLSGYIPPKRKQGQGLSLCQNGESPNC    281 - 350
VEDKMLSTVAVLTLG                                                           351 - 365
//

Text Mined References (17)

PMID Year Title