Property Summary

NCBI Gene PubMed Count 14
Grant Count 35
R01 Count 24
Funding $5,995,013.94
PubMed Score 205.21
PubTator Score 65.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
psoriasis 1.100 0.000
osteosarcoma 2.292 0.000
acute quadriplegic myopathy 1.058 0.000
intraductal papillary-mucinous adenoma (... 1.600 0.002
intraductal papillary-mucinous carcinoma... 1.600 0.009
lung cancer 1.500 0.002
colon cancer 1.400 0.006
ovarian cancer 3.800 0.000

AA Sequence

MDPPAVVAESVSSLTIADAFIAAGESSAPTPPRPALPRRFICSFPDCSANYSKAWKLDAHLCKHTGERPF      1 - 70
VCDYEGCGKAFIRDYHLSRHILTHTGEKPFVCAANGCDQKFNTKSNLKKHFERKHENQQKQYICSFEDCK     71 - 140
KTFKKHQQLKIHQCQHTNEPLFKCTQEGCGKHFASPSKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVR    141 - 210
ETHKEEILCEVCRKTFKRKDYLKQHMKTHAPERDVCRCPREGCGRTYTTVFNLQSHILSFHEESRPFVCE    211 - 280
HAGCGKTFAMKQSLTRHAVVHDPDKKKMKLKVKKSREKRSLASHLSGYIPPKRKQGQGLSLCQNGESPNC    281 - 350
VEDKMLSTVAVLTLG                                                           351 - 365
//

Text Mined References (16)

PMID Year Title
20935630 2010 Association analyses of 249,796 individuals reveal 18 new loci associated with body mass index.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17474147 2007 Systematic identification of SH3 domain-mediated human protein-protein interactions by peptide array target screening.
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
15057823 2004 The DNA sequence and analysis of human chromosome 13.
12711686 2003 Assembly and isolation of intermediate steps of transcription complexes formed on the human 5S rRNA gene.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11814676 2002 cDNA cloning, DNA binding, and evolution of mammalian transcription factor IIIA.
10756201 2000 Identification of a transcription factor IIIA-interacting protein.
More...