Property Summary

NCBI Gene PubMed Count 20
PubMed Score 27.44
PubTator Score 16.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
aldosterone-producing adenoma -1.047 3.6e-02
astrocytic glioma -1.400 4.7e-02
atypical teratoid / rhabdoid tumor -1.500 5.9e-04
Breast cancer -1.200 2.1e-08
diabetes mellitus -1.200 1.2e-03
glioblastoma -1.100 3.4e-03
medulloblastoma, large-cell -1.300 6.6e-04
Multiple myeloma 1.424 1.3e-02
oligodendroglioma -1.900 2.9e-02
ovarian cancer -1.100 3.0e-04
tuberculosis 1.500 1.4e-06

Gene RIF (5)

AA Sequence

MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYR      1 - 70
SVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGRIP     71 - 140
PSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGAS    141 - 210
MYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLC    211 - 280
VSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLP    281 - 350
VAQIIHQKPKLKDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF                             351 - 395
//

Text Mined References (22)

PMID Year Title