Property Summary

NCBI Gene PubMed Count 19
PubMed Score 27.91
PubTator Score 16.70

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 2.14744309989411E-8
tuberculosis 1563 1.42142203895502E-6
ovarian cancer 8492 2.9611628152472E-4
atypical teratoid / rhabdoid tumor 4369 5.8710197853293E-4
medulloblastoma, large-cell 6234 6.63834429634043E-4
diabetes mellitus 1663 0.00115491370316007
glioblastoma 5572 0.00339252612086188
Multiple myeloma 1328 0.012915628061184
oligodendroglioma 2849 0.0289137876929141
aldosterone-producing adenoma 664 0.0356484209386552
astrocytic glioma 2241 0.0468989278740227
Disease Target Count Z-score Confidence
Fungal meningitis 7 4.824 2.4
Malaria 140 3.013 1.5

Expression

  Differential Expression (11)

Disease log2 FC p
Multiple myeloma 1.424 0.013
astrocytic glioma -1.400 0.047
oligodendroglioma -1.900 0.029
atypical teratoid / rhabdoid tumor -1.500 0.001
glioblastoma -1.100 0.003
medulloblastoma, large-cell -1.300 0.001
tuberculosis 1.500 0.000
diabetes mellitus -1.200 0.001
aldosterone-producing adenoma -1.047 0.036
Breast cancer -1.200 0.000
ovarian cancer -1.100 0.000

Synonym

Gene

PANTHER Protein Class (1)

  Ortholog (12)

Gene RIF (3)

PMID Text
22824918 Our results demonstrate, for the first time, a link between the SNP 1048575 and low PIGK expression in CRC/HCC patients and also suggest a possible association between altered PIGK expression and disease susceptibility.
18187620 Knockdown of phosphatidylinositol glycan anchor biosynthesis, class K (PIGK) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
12582175 GPI8 and PIG-T form a functionally important intermolecular disulfide bridge

AA Sequence

MAVTDSLSRAATVLATVLLLSFGSVAASHIEDQAEQFFRSGHTNNWAVLVCTSRFWFNYRHVANTLSVYR      1 - 70
SVKRLGIPDSHIVLMLADDMACNPRNPKPATVFSHKNMELNVYGDDVEVDYRSYEVTVENFLRVLTGRIP     71 - 140
PSTPRSKRLLSDDRSNILIYMTGHGGNGFLKFQDSEEITNIELADAFEQMWQKRRYNELLFIIDTCQGAS    141 - 210
MYERFYSPNIMALASSQVGEDSLSHQPDPAIGVHLMDRYTFYVLEFLEEINPASQTNMNDLFQVCPKSLC    211 - 280
VSTPGHRTDLFQRDPKNVLITDFFGSVRKVEITTETIKLQQDSEIMESSYKEDQMDEKLMEPLKYAEQLP    281 - 350
VAQIIHQKPKLKDWHPPGGFILGLWALIIMVFFKTYGIKHMKFIF                             351 - 395
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
22824918 2012 A single nucleotide polymorphism in the human PIGK gene associates with low PIGK expression in colorectal cancer patients.
21269460 2011 Initial characterization of the human central proteome.
19946888 2010 Defining the membrane proteome of NK cells.
17207965 2007 hORFeome v3.1: a resource of human open reading frames representing over 10,000 human genes.
16710414 2006 The DNA sequence and biological annotation of human chromosome 1.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12802054 2003 Human PIG-U and yeast Cdc91p are the fifth subunit of GPI transamidase that attaches GPI-anchors to proteins.
More...