Property Summary

NCBI Gene PubMed Count 12
PubMed Score 2.04
PubTator Score 1.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Disease Target Count P-value
psoriasis 6694 1.5e-20

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis 1.500 1.5e-20

Gene RIF (6)

AA Sequence

MWFLTTLLLWVPVDGQVDTTKAVITLQPPWVSVFQEETVTLHCEVLHLPGSSSTQWFLNGTATQTSTPSY      1 - 70
RITSASVNDSGEYRCQRGLSGRSDPIQLEIHRGWLLLQVSSRVFMEGEPLALRCHAWKDKLVYNVLYYRN     71 - 140
GKAFKFFHWNSNLTILKTNISHNGTYHCSGMGKHRYTSAGISQYTVKGLQLPTPVWFHVLFYLAVGIMFL    141 - 210
VNTVLWVTIRKELKRKKKWNLEISLDSGHEKKVISSLQEDRHLEEELKCQEQKEEQLQEGVHRKEPQGAT    211 - 280
//

Text Mined References (15)

PMID Year Title