Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.66
PubTator Score 49.89

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.4460471036231E-6
malignant mesothelioma 3163 2.60498483775389E-6
psoriasis 6685 3.40314921213246E-5
tuberculosis and treatment for 6 months 686 4.54971115819621E-5
ovarian cancer 8492 2.33802143536272E-4
sonic hedgehog group medulloblastoma 1482 5.001612716711E-4
oligodendroglioma 2849 0.0014778074000187
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00762347428700204
astrocytic glioma 2241 0.00840454280361081
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0110989536014835
subependymal giant cell astrocytoma 2287 0.0209650144507765
Disease Target Count Z-score Confidence
Chediak-Higashi syndrome 24 3.417 1.7

Expression

Synonym

Accession Q92636 B4DFB0 E9PCH0 Q8IW26
Symbols FAN
GRAMD5

Gene

PANTHER Protein Class (1)

  Ortholog (10)

 GWAS Trait (1)

Gene RIF (5)

PMID Text
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
18653803 Regulation of NSMAF by TNF-alpha involves PRKCD in lung epithelial cells.
15653433 sphingolipid activator proteins like domain may stabilize the fold of acid sphingomyelinase
12391233 The interaction of FAN with receptor for activated C-kinase 1 (RACK1) appears to be dependent on the folding of the WD repeats into a secondary structure, because no linear binding motifs are identified in the WD-repeat region of FAN.

AA Sequence

MAFIRKKQQEQQLQLYSKERFSLLLLNLEEYYFEQHRANHILHKGSHHERKIRGSLKICSKSVIFEPDSI      1 - 70
SQPIIKIPLRDCIKIGKHGENGANRHFTKAKSGGISLIFSQVYFIKEHNVVAPYKIERGKMEYVFELDVP     71 - 140
GKVEDVVETLLQLHRASCLDKLGDQTAMITAILQSRLARTSFDKNRFQNISEKLHMECKAEMVTPLVTNP    141 - 210
GHVCITDTNLYFQPLNGYPKPVVQITLQDVRRIYKRRHGLMPLGLEVFCTEDDLCSDIYLKFYEPQDRDD    211 - 280
LYFYIATYLEHHVAEHTAESYMLQWQRGHLSNYQYLLHLNNLADRSCNDLSQYPVFPWIIHDYSSSELDL    281 - 350
SNPGTFRDLSKPVGALNKERLERLLTRYQEMPEPKFMYGSHYSSPGYVLFYLVRIAPEYMLCLQNGRFDN    351 - 420
ADRMFNSIAETWKNCLDGATDFKELIPEFYGDDVSFLVNSLKLDLGKRQGGQMVDDVELPPWASSPEDFL    421 - 490
QKSKDALESNYVSEHLHEWIDLIFGYKQKGSDAVGAHNVFHPLTYEGGVDLNSIQDPDEKVAMLTQILEF    491 - 560
GQTPKQLFVTPHPRRITPKFKSLSQTSSYNASMADSPGEESFEDLTEESKTLAWNNITKLQLHEHYKIHK    561 - 630
EAVTGITVSRNGSSVFTTSQDSTLKMFSKESKMLQRSISFSNMALSSCLLLPGDATVITSSWDNNVYFYS    631 - 700
IAFGRRQDTLMGHDDAVSKICWHDNRLYSASWDSTVKVWSGVPAEMPGTKRHHFDLLAELEHDVSVDTIS    701 - 770
LNAASTLLVSGTKEGTVNIWDLTTATLMHQIPCHSGIVCDTAFSPDSRHVLSTGTDGCLNVIDVQTGMLI    771 - 840
SSMTSDEPQRCFVWDGNSVLSGSQSGELLVWDLLGAKISERIQGHTGAVTCIWMNEQCSSIITGGEDRQI    841 - 910
IFWKLQY                                                                   911 - 917
//

Text Mined References (16)

PMID Year Title
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20562859 2010 Network organization of the human autophagy system.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
18653803 2008 Regulation of neutral sphingomyelinase-2 (nSMase2) by tumor necrosis factor-alpha involves protein kinase C-delta in lung epithelial cells.
17599063 2007 PtdIns(4,5)P-restricted plasma membrane localization of FAN is involved in TNF-induced actin reorganization.
16421571 2006 DNA sequence and analysis of human chromosome 8.
15653433 2004 Functional characterization of the postulated intramolecular sphingolipid activator protein domain of human acid sphingomyelinase.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...