Property Summary

NCBI Gene PubMed Count 14
PubMed Score 8.30
PubTator Score 49.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
astrocytic glioma 1.400 8.4e-03
intraductal papillary-mucinous adenoma (... 1.100 7.6e-03
intraductal papillary-mucinous carcinoma... 1.300 1.1e-02
malignant mesothelioma 1.300 2.6e-06
oligodendroglioma 1.400 1.5e-03
osteosarcoma 1.869 1.4e-06
ovarian cancer -1.300 6.5e-06
psoriasis 1.700 3.4e-05
sonic hedgehog group medulloblastoma 1.100 5.0e-04
subependymal giant cell astrocytoma 1.393 2.1e-02
tuberculosis -1.400 1.4e-06

Protein-protein Interaction (10)

Gene RIF (5)

AA Sequence

MAFIRKKQQEQQLQLYSKERFSLLLLNLEEYYFEQHRANHILHKGSHHERKIRGSLKICSKSVIFEPDSI      1 - 70
SQPIIKIPLRDCIKIGKHGENGANRHFTKAKSGGISLIFSQVYFIKEHNVVAPYKIERGKMEYVFELDVP     71 - 140
GKVEDVVETLLQLHRASCLDKLGDQTAMITAILQSRLARTSFDKNRFQNISEKLHMECKAEMVTPLVTNP    141 - 210
GHVCITDTNLYFQPLNGYPKPVVQITLQDVRRIYKRRHGLMPLGLEVFCTEDDLCSDIYLKFYEPQDRDD    211 - 280
LYFYIATYLEHHVAEHTAESYMLQWQRGHLSNYQYLLHLNNLADRSCNDLSQYPVFPWIIHDYSSSELDL    281 - 350
SNPGTFRDLSKPVGALNKERLERLLTRYQEMPEPKFMYGSHYSSPGYVLFYLVRIAPEYMLCLQNGRFDN    351 - 420
ADRMFNSIAETWKNCLDGATDFKELIPEFYGDDVSFLVNSLKLDLGKRQGGQMVDDVELPPWASSPEDFL    421 - 490
QKSKDALESNYVSEHLHEWIDLIFGYKQKGSDAVGAHNVFHPLTYEGGVDLNSIQDPDEKVAMLTQILEF    491 - 560
GQTPKQLFVTPHPRRITPKFKSLSQTSSYNASMADSPGEESFEDLTEESKTLAWNNITKLQLHEHYKIHK    561 - 630
EAVTGITVSRNGSSVFTTSQDSTLKMFSKESKMLQRSISFSNMALSSCLLLPGDATVITSSWDNNVYFYS    631 - 700
IAFGRRQDTLMGHDDAVSKICWHDNRLYSASWDSTVKVWSGVPAEMPGTKRHHFDLLAELEHDVSVDTIS    701 - 770
LNAASTLLVSGTKEGTVNIWDLTTATLMHQIPCHSGIVCDTAFSPDSRHVLSTGTDGCLNVIDVQTGMLI    771 - 840
SSMTSDEPQRCFVWDGNSVLSGSQSGELLVWDLLGAKISERIQGHTGAVTCIWMNEQCSSIITGGEDRQI    841 - 910
IFWKLQY                                                                   911 - 917
//

Text Mined References (17)

PMID Year Title