Property Summary

NCBI Gene PubMed Count 26
Grant Count 2
Funding $62,985.6
PubMed Score 30.13
PubTator Score 27.91

Knowledge Summary

Patent (3,632)

Expression

Synonym

Accession Q92630 B2R9V9 Q9BRB5
Symbols

Gene

 Grant Application (2)

PDB

3K2L   3KVW   4AZF  

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 Collection (1)

Gene RIF (14)

PMID Text
26341817 Silencing of DYRK2 increases cell proliferation but reverses CAM-DR in Non-Hodgkin's Lymphoma
25712377 DYRK2 may regulate EMT through Snail degradation in ovarian SA and might be a predictive marker for a favorable prognosis in the treatment of this cancer.
25095982 Downregulation of DYRK2 is associated with recurrence in early stage breast cancer.
24438055 DYRK2-dependent phosphorylation of pregnane X receptor facilitates its subsequent ubiquitination by UBR5.
24162774 HIV-1 gp120 upregulates the expression of dual-specificity tyrosine (Y)-phosphorylation regulated kinase 2 (DYRK2) in human B cells
23791882 DYRK2 controls the epithelial-mesenchymal transition in breast cancer by degrading Snail.
23362280 Data indicate that Dyrk2 phosphorylates TERT protein, which is then associated with the EDD-DDB1-VprBP E3 ligase complex for subsequent ubiquitin-mediated TERT protein degradation.
22878263 DYRK2-mediated phosphorylation of p53 at Ser46 is impaired under hypoxic conditions, suggesting a molecular mechanism underlying chemotherapy resistance in solid tumors.
22307329 DYRK2 regulates tumor progression through modulation of c-Jun and c-Myc
19965871 The findings indicate that ATM controls stability and pro-apoptotic function of DYRK2 in response to DNA damage.
More...

AA Sequence

MLTRKPSAAAPAAYPTGRGGDSAVRQLQASPGLGAGATRSGVGTGPPSPIALPPLRASNAAAAAHTIGGS      1 - 70
KHTMNDHLHVGSHAHGQIQVQQLFEDNSNKRTVLTTQPNGLTTVGKTGLPVVPERQLDSIHRRQGSSTSL     71 - 140
KSMEGMGKVKATPMTPEQAMKQYMQKLTAFEHHEIFSYPEIYFLGLNAKKRQGMTGGPNNGGYDDDQGSY    141 - 210
VQVPHDHVAYRYEVLKVIGKGSFGQVVKAYDHKVHQHVALKMVRNEKRFHRQAAEEIRILEHLRKQDKDN    211 - 280
TMNVIHMLENFTFRNHICMTFELLSMNLYELIKKNKFQGFSLPLVRKFAHSILQCLDALHKNRIIHCDLK    281 - 350
PENILLKQQGRSGIKVIDFGSSCYEHQRVYTYIQSRFYRAPEVILGARYGMPIDMWSLGCILAELLTGYP    351 - 420
LLPGEDEGDQLACMIELLGMPSQKLLDASKRAKNFVSSKGYPRYCTVTTLSDGSVVLNGGRSRRGKLRGP    421 - 490
PESREWGNALKGCDDPLFLDFLKQCLEWDPAVRMTPGQALRHPWLRRRLPKPPTGEKTSVKRITESTGAI    491 - 560
TSISKLPPPSSSASKLRTNLAQMTDANGNIQQRTVLPKLVS                                 561 - 601
//

Text Mined References (40)

PMID Year Title
26341817 2015 Silencing of DYRK2 increases cell proliferation but reverses CAM-DR in Non-Hodgkin's Lymphoma.
25712377 2015 DYRK2 regulates epithelial-mesenchymal-transition and chemosensitivity through Snail degradation in ovarian serous adenocarcinoma.
25416956 2014 A proteome-scale map of the human interactome network.
25095982 2014 Downregulation of DYRK2 can be a predictor of recurrence in early stage breast cancer.
24438055 2014 Stability of the human pregnane X receptor is regulated by E3 ligase UBR5 and serine/threonine kinase DYRK2.
23791882 2013 DYRK2 controls the epithelial-mesenchymal transition in breast cancer by degrading Snail.
23665168 2013 Structures of Down syndrome kinases, DYRKs, reveal mechanisms of kinase activation and substrate recognition.
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23362280 2013 Dyrk2-associated EDD-DDB1-VprBP E3 ligase inhibits telomerase by TERT degradation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...