Property Summary

NCBI Gene PubMed Count 46
PubMed Score 131.29
PubTator Score 42.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (7)

Disease Target Count P-value
pituitary cancer 1972 4.02568896889199E-9
osteosarcoma 7933 4.12214043133073E-7
pilocytic astrocytoma 3086 9.97802467747413E-6
intraductal papillary-mucinous carcinoma (IPMC) 2988 2.11750736647795E-4
atypical teratoid / rhabdoid tumor 4369 4.58828350424035E-4
lung cancer 4473 7.44445187752298E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00105372996994162
group 4 medulloblastoma 1875 0.00130796596407287
invasive ductal carcinoma 2950 0.00222718958300386
hereditary spastic paraplegia 313 0.00224848511617536
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.0036864109843053
adult high grade glioma 2148 0.00547145966724178
subependymal giant cell astrocytoma 2287 0.00865438099302498
colon cancer 1475 0.0137602035127438
interstitial lung disease 292 0.0295156545180735
primitive neuroectodermal tumor 3031 0.0325853895113209
glioblastoma 5572 0.0368442297048367
cutaneous lupus erythematosus 1056 0.0476755660577461
Disease Target Count Z-score Confidence
Autistic Disorder 320 0.0 1.0
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 51 0.0 5.0
Disease Target Count Z-score Confidence
Muscular dystrophy 48 6.219 3.1
Muscular atrophy 67 3.109 1.6

Expression

Synonym

Accession Q92629 A8K9S9 Q53XA5 Q99644 Delta-SG
Symbols SGD
DAGD
35DAG
CMD1L
SGCDP
SG-delta

Gene

PANTHER Protein Class (1)

  Ortholog (9)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid

Gene RIF (16)

PMID Text
26720722 haplotype -_G composed of c.-100~-110 and A848G confers higher susceptibility to dilated cardiomyopathy in the Mongoloid population.
25474115 CC genotype of the delta-sarcoglycan gene polymorphism rs13170573 is associated with obstructive sleep apnea in the Chinese population
23786442 Genetic variation at the delta-sarcoglycan locus elevates heritable sympathetic nerve activity in human twin pairs
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20474083 Observational study of genetic testing. (HuGE Navigator)
20384457 Observational study of genotype prevalence. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20181037 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20161521 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPQEQYTHHRSTMPGSVGPQVYKVGIYGWRKRCLYFFVLLLMILILVNLAMTIWILKVMNFTIDGMGNLR      1 - 70
ITEKGLKLEGDSEFLQPLYAKEIQSRPGNALYFKSARNVTVNILNDQTKVLTQLITGPKAVEAYGKKFEV     71 - 140
KTVSGKLLFSADNNEVVVGAERLRVLGAEGTVFPKSIETPNVRADPFKELRLESPTRSLVMEAPKGVEIN    141 - 210
AEAGNMEATCRTELRLESKDGEIKLDAAKIRLPRLPHGSYTPTGTRQKVFEICVCANGRLFLSQAGAGST    211 - 280
CQINTSVCL                                                                 281 - 289
//

Text Mined References (47)

PMID Year Title
26720722 2015 A Haplotype of Two Novel Polymorphisms in ?-Sarcoglycan Gene Increases Risk of Dilated Cardiomyopathy in Mongoloid Population.
25474115 2014 The CC genotype of the delta-sarcoglycan gene polymorphism rs13170573 is associated with obstructive sleep apnea in the Chinese population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23786442 2013 Genetic variation at the delta-sarcoglycan (SGCD) locus elevates heritable sympathetic nerve activity in human twin pairs.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20474083 2010 A novel custom resequencing array for dilated cardiomyopathy.
20384457 2010 Delta-sarcoglycan gene polymorphism frequency in Amerindian and Mestizo populations of Mexico.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...