Property Summary

NCBI Gene PubMed Count 47
PubMed Score 140.76
PubTator Score 42.91

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Autistic Disorder 364 0.0 1.8
Disease Target Count Z-score Confidence
Dilated cardiomyopathy 56 0.0 5.0
Disease Target Count Z-score Confidence
Muscular atrophy 71 3.174 1.6

Expression

Protein-protein Interaction (4)

Gene RIF (17)

AA Sequence

MPQEQYTHHRSTMPGSVGPQVYKVGIYGWRKRCLYFFVLLLMILILVNLAMTIWILKVMNFTIDGMGNLR      1 - 70
ITEKGLKLEGDSEFLQPLYAKEIQSRPGNALYFKSARNVTVNILNDQTKVLTQLITGPKAVEAYGKKFEV     71 - 140
KTVSGKLLFSADNNEVVVGAERLRVLGAEGTVFPKSIETPNVRADPFKELRLESPTRSLVMEAPKGVEIN    141 - 210
AEAGNMEATCRTELRLESKDGEIKLDAAKIRLPRLPHGSYTPTGTRQKVFEICVCANGRLFLSQAGAGST    211 - 280
CQINTSVCL                                                                 281 - 289
//

Text Mined References (48)

PMID Year Title