Property Summary

NCBI Gene PubMed Count 46
Grant Count 66
R01 Count 43
Funding $8,315,215.28
PubMed Score 131.29
PubTator Score 42.91

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession Q92629 A8K9S9 Q53XA5 Q99644 Delta-SG
Symbols SGD
DAGD
35DAG
CMD1L
SGCDP
SG-delta

Gene

PANTHER Protein Class (1)

Gene RIF (16)

PMID Text
26720722 haplotype -_G composed of c.-100~-110 and A848G confers higher susceptibility to dilated cardiomyopathy in the Mongoloid population.
25474115 CC genotype of the delta-sarcoglycan gene polymorphism rs13170573 is associated with obstructive sleep apnea in the Chinese population
23786442 Genetic variation at the delta-sarcoglycan locus elevates heritable sympathetic nerve activity in human twin pairs
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20474083 Observational study of genetic testing. (HuGE Navigator)
20384457 Observational study of genotype prevalence. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20181037 Observational study and genome-wide association study of gene-disease association. (HuGE Navigator)
20161521 Observational study and genome-wide association study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19913121 Observational study of gene-disease association. (HuGE Navigator)
More...

AA Sequence

MPQEQYTHHRSTMPGSVGPQVYKVGIYGWRKRCLYFFVLLLMILILVNLAMTIWILKVMNFTIDGMGNLR      1 - 70
ITEKGLKLEGDSEFLQPLYAKEIQSRPGNALYFKSARNVTVNILNDQTKVLTQLITGPKAVEAYGKKFEV     71 - 140
KTVSGKLLFSADNNEVVVGAERLRVLGAEGTVFPKSIETPNVRADPFKELRLESPTRSLVMEAPKGVEIN    141 - 210
AEAGNMEATCRTELRLESKDGEIKLDAAKIRLPRLPHGSYTPTGTRQKVFEICVCANGRLFLSQAGAGST    211 - 280
CQINTSVCL                                                                 281 - 289
//

Text Mined References (47)

PMID Year Title
26720722 2015 A Haplotype of Two Novel Polymorphisms in ?-Sarcoglycan Gene Increases Risk of Dilated Cardiomyopathy in Mongoloid Population.
25474115 2014 The CC genotype of the delta-sarcoglycan gene polymorphism rs13170573 is associated with obstructive sleep apnea in the Chinese population.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24023788 2013 Gene network analysis in a pediatric cohort identifies novel lung function genes.
23786442 2013 Genetic variation at the delta-sarcoglycan (SGCD) locus elevates heritable sympathetic nerve activity in human twin pairs.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20474083 2010 A novel custom resequencing array for dilated cardiomyopathy.
20384457 2010 Delta-sarcoglycan gene polymorphism frequency in Amerindian and Mestizo populations of Mexico.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...