Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.34
PubTator Score 22.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.7

Expression

  Differential Expression (9)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.100 1.2e-04
glioblastoma -1.300 2.9e-03
lung cancer -1.500 2.7e-03
medulloblastoma, large-cell -1.600 3.1e-04
osteosarcoma 1.217 5.0e-04
ovarian cancer -1.500 1.1e-05
psoriasis -1.300 2.0e-09
tuberculosis -1.700 1.1e-06
ulcerative colitis -1.051 2.3e-02

 GO Function (1)

Gene RIF (2)

AA Sequence

MAAVELEWIPETLYNTAISAVVDNYIRSRRDIRSLPENIQFDVYYKLYQQGRLCQLGSEFCELEVFAKVL      1 - 70
RALDKRHLLHHCFQALMDHGVKVASVLAYSFSRRCSYIAESDAAVKEKAIQVGFVLGGFLSDAGWYSDAE     71 - 140
KVFLSCLQLCTLHDEMLHWFRAVECCVRLLHVRNGNCKYHLGEETFKLAQTYMDKLSKHGQQANKAALYG    141 - 210
ELCALLFAKSHYDEAYKWCIEAMKEITAGLPVKVVVDVLRQASKACVVKREFKKAEQLIKHAVYLARDHF    211 - 280
GSKHPKYSDTLLDYGFYLLNVDNICQSVAIYQAALDIRQSVFGGKNIHVATAHEDLAYSSYVHQYSSGKF    281 - 350
DNALFHAERAIGIITHILPEDHLLLASSKRVKALILEEIAIDCHNKETEQRLLQEAHDLHLSSLQLAKKA    351 - 420
FGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEVALSVGHLASLYNYDMNQYEN    421 - 490
AEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDV    491 - 560
STSPQSTEEVVQSFLISQNVEGPSC                                                 561 - 585
//

Text Mined References (17)

PMID Year Title