Property Summary

NCBI Gene PubMed Count 16
Grant Count 64
R01 Count 43
Funding $7,638,349.24
PubMed Score 2.93
PubTator Score 22.46

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
psoriasis -1.300 0.000
osteosarcoma 1.217 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.300 0.003
medulloblastoma, large-cell -1.600 0.000
ulcerative colitis -1.051 0.023
tuberculosis -1.700 0.000
lung cancer -2.400 0.007
ovarian cancer -1.800 0.000

Synonym

Accession Q92624 A8K862 O95095 Q8WVC9
Symbols PAT1
APP-BP2
HS.84084

Gene

 GO Function (1)

Gene RIF (2)

PMID Text
25194880 It facilitates the regulator of calcineurin 1-mediated apoptosis by downregulating proteasome subunits.
12915535 Association of the herpes simplex virus type 1 Us11 gene product with the cellular kinesin light-chain-related protein PAT1 results in the redistribution of both polypeptides.

AA Sequence

MAAVELEWIPETLYNTAISAVVDNYIRSRRDIRSLPENIQFDVYYKLYQQGRLCQLGSEFCELEVFAKVL      1 - 70
RALDKRHLLHHCFQALMDHGVKVASVLAYSFSRRCSYIAESDAAVKEKAIQVGFVLGGFLSDAGWYSDAE     71 - 140
KVFLSCLQLCTLHDEMLHWFRAVECCVRLLHVRNGNCKYHLGEETFKLAQTYMDKLSKHGQQANKAALYG    141 - 210
ELCALLFAKSHYDEAYKWCIEAMKEITAGLPVKVVVDVLRQASKACVVKREFKKAEQLIKHAVYLARDHF    211 - 280
GSKHPKYSDTLLDYGFYLLNVDNICQSVAIYQAALDIRQSVFGGKNIHVATAHEDLAYSSYVHQYSSGKF    281 - 350
DNALFHAERAIGIITHILPEDHLLLASSKRVKALILEEIAIDCHNKETEQRLLQEAHDLHLSSLQLAKKA    351 - 420
FGEFNVQTAKHYGNLGRLYQSMRKFKEAEEMHIKAIQIKEQLLGQEDYEVALSVGHLASLYNYDMNQYEN    421 - 490
AEKLYLRSIAIGKKLFGEGYSGLEYDYRGLIKLYNSIGNYEKVFEYHNVLSNWNRLRDRQYSVTDALEDV    491 - 560
STSPQSTEEVVQSFLISQNVEGPSC                                                 561 - 585
//

Text Mined References (17)

PMID Year Title
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
25416956 2014 A proteome-scale map of the human interactome network.
25194880 2015 Amyloid-? precursor protein facilitates the regulator of calcineurin 1-mediated apoptosis by downregulating proteasome subunit ? type-5 and proteasome subunit ? type-7.
21118134 2010 Pat1 proteins: a life in translation, translation repression and mRNA decay.
19570594 2011 PAT1 induces cell death signal and SET mislocalization into the cytoplasm by increasing APP/APLP2 at the cell surface.
19060904 2009 An empirical framework for binary interactome mapping.
16189514 2005 Towards a proteome-scale map of the human protein-protein interaction network.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
More...