Property Summary

NCBI Gene PubMed Count 7
PubMed Score 6.13
PubTator Score 5.53

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
malignant mesothelioma 3.100 0.000
astrocytic glioma -2.500 0.001
ependymoma -1.800 0.020
oligodendroglioma -2.000 0.010
esophageal adenocarcinoma -2.400 0.020
glioblastoma -3.200 0.000
osteosarcoma -1.295 0.000
atypical teratoid / rhabdoid tumor -2.800 0.000
sonic hedgehog group medulloblastoma -1.900 0.000
medulloblastoma, large-cell -2.700 0.006
intraductal papillary-mucinous neoplasm ... 1.900 0.001
lung cancer 2.800 0.000
colon cancer 1.900 0.000
pancreatic cancer 1.100 0.001
adult high grade glioma -2.600 0.000
pilocytic astrocytoma -1.400 0.002
nasopharyngeal carcinoma -2.300 0.000
spina bifida -2.217 0.046
ductal carcinoma in situ 1.600 0.024
invasive ductal carcinoma 2.200 0.009
ulcerative colitis 1.300 0.000
psoriasis 1.200 0.000

Gene RIF (2)

PMID Text
25798063 It is plausible therefore that TTC9A negatively regulates ERalpha activity through interacting with co-chaperone proteins such as FKBP38 and FKBP51.
18699990 TTC9A acts as a chaperone protein to facilitate the function of tropomyosins (including Tm5NM-1) in stabilizing microfilament and it may play a role in cancer cell invasion and metastasis

AA Sequence

MERKGSAAGAKGNPSPPAAGEGQRPPPPLCVPGGGGGAPARGQVGAAAEPAELIRRAHEFKSQGAQCYKD      1 - 70
KKFREAIGKYHRALLELKGLLPPPGERERDSRPASPAGALKPGRLSEEQSKTVEAIEIDCYNSLAACLLQ     71 - 140
AELVNYERVKEYCLKVLKKEGENFKALYRSGVAFYHLGDYDKALYYLKEARTQQPTDTNVIRYIQLTEMK    141 - 210
LSRCSQREKEAM                                                              211 - 222
//

Text Mined References (9)

PMID Year Title
25798063 2015 Tetratricopeptide repeat domain 9A negatively regulates estrogen receptor alpha activity.
25217961 2014 A meta-analysis of 87,040 individuals identifies 23 new susceptibility loci for prostate cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
18699990 2008 Tetratricopeptide repeat domain 9A is an interacting protein for tropomyosin Tm5NM-1.
16678794 2006 Identification of tetratricopeptide repeat domain 9, a hormonally regulated protein.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
12508121 2003 The DNA sequence and analysis of human chromosome 14.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
9039502 1996 Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain.