Property Summary

NCBI Gene PubMed Count 25
Grant Count 23
R01 Count 16
Funding $2,459,309.29
PubMed Score 78.62
PubTator Score 72.99

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
ependymoma -1.200 0.019
osteosarcoma -2.147 0.000
astrocytoma 1.300 0.003
medulloblastoma, large-cell -1.600 0.000
juvenile dermatomyositis 1.998 0.000
lung cancer -1.600 0.013
ovarian cancer 2.100 0.000

Gene RIF (11)

PMID Text
25807108 HCV, by differentially inducing the expression of Rubicon and UVRAG, temporally regulated the autophagic flux to enhance its replication.
23728897 This study demonistrated that KIAA0226 mutation impairs Rubicon endosomal localization
22527681 New DNA sequencing technologies are enabling us to investigate the whole or large targeted proportions of the genome in a rapid, affordable, and comprehensive way. Exome and targeted sequencing rundataxin genes causing ataxia.
22423967 Rubicon differentially targets signaling complexes, depending on environmental stimuli, and may function to coordinate various immune responses against microbial infection.
22423966 Rubicon may thus be pivotal to generating an optimal intracellular immune response against microbial infection.
21062745 a critical role of the Rubicon RUN domain in PI3KC3 and autophagy regulation
20974968 Rubicon serves as a previously unknown Rab7 effector to ensure the proper progression of the endocytic pathway.
20943950 Rubicon and PLEKHM1 specifically and directly interact with Rab7 via their RH domain; this interaction is critical for their function; show Rubicon but not PLEKHM1 uniquely regulates membrane trafficking via simultaneously binding both Rab7 and PI3-kinase
20826435 we report the identification of a family with three children affected with a new form of recessive ataxia, which we suggest naming 'Salih ataxia', and of a frameshift mutation of KIAA0226 (rundataxin) that segregates with the disease
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MRPEGAGMELGGGEERLPEESRREHWQLLGNLKTTVEGLVSTNSPNVWSKYGGLERLCRDMQSILYHGLI      1 - 70
RDQACRRQTDYWQFVKDIRWLSPHSALHVEKFISVHENDQSSADGASERAVAELWLQHSLQYHCLSAQLR     71 - 140
PLLGDRQYIRKFYTDAAFLLSDAHVTAMLQCLEAVEQNNPRLLAQIDASMFARKHESPLLVTKSQSLTAL    141 - 210
PSSTYTPPNSYAQHSYFGSFSSLHQSVPNNGSERRSTSFPLSGPPRKPQESRGHVSPAEDQTIQAPPVSV    211 - 280
SALARDSPLTPNEMSSSTLTSPIEASWVSSQNDSPGDASEGPEYLAIGNLDPRGRTASCQSHSSNAESSS    281 - 350
SNLFSSSSSQKPDSAASSLGDQEGGGESQLSSVLRRSSFSEGQTLTVTSGAKKSHIRSHSDTSIASRGAP    351 - 420
ESCNDKAKLRGPLPYSGQSSEVSTPSSLYMEYEGGRYLCSGEGMFRRPSEGQSLISYLSEQDFGSCADLE    421 - 490
KENAHFSISESLIAAIELMKCNMMSQCLEEEEVEEEDSDREIQELKQKIRLRRQQIRTKNLLPMYQEAEH    491 - 560
GSFRVTSSSSQFSSRDSAQLSDSGSADEVDEFEIQDADIRRNTASSSKSFVSSQSFSHCFLHSTSAEAVA    561 - 630
MGLLKQFEGMQLPAASELEWLVPEHDAPQKLLPIPDSLPISPDDGQHADIYKLRIRVRGNLEWAPPRPQI    631 - 700
IFNVHPAPTRKIAVAKQNYRCAGCGIRTDPDYIKRLRYCEYLGKYFCQCCHENAQMAIPSRVLRKWDFSK    701 - 770
YYVSNFSKDLLIKIWNDPLFNVQDINSALYRKVKLLNQVRLLRVQLCHMKNMFKTCRLAKELLDSFDTVP    771 - 840
GHLTEDLHLYSLNDLTATRKGELGPRLAELTRAGATHVERCMLCQAKGFICEFCQNEDDIIFPFELHKCR    841 - 910
TCEECKACYHKACFKSGSCPRCERLQARREALARQSLESYLSDYEEEPAEALALEAAVLEAT            911 - 972
//

Text Mined References (30)

PMID Year Title
25807108 2015 HCV induces the expression of Rubicon and UVRAG to temporally regulate the maturation of autophagosomes and viral replication.
25594178 2015 A kinase-independent role for EGF receptor in autophagy initiation.
24034250 2013 EGFR-mediated Beclin 1 phosphorylation in autophagy suppression, tumor progression, and tumor chemoresistance.
23954414 2013 Beclin 2 functions in autophagy, degradation of G protein-coupled receptors, and metabolism.
23728897 2013 The Salih ataxia mutation impairs Rubicon endosomal localization.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22527681 2012 Recent advances in the genetics of cerebellar ataxias.
22493499 2012 Receptor signaling lymphocyte-activation molecule family 1 (Slamf1) regulates membrane fusion and NADPH oxidase 2 (NOX2) activity by recruiting a Beclin-1/Vps34/ultraviolet radiation resistance-associated gene (UVRAG) complex.
22423967 2012 The autophagy regulator Rubicon is a feedback inhibitor of CARD9-mediated host innate immunity.
22423966 2012 Autophagy protein Rubicon mediates phagocytic NADPH oxidase activation in response to microbial infection or TLR stimulation.
More...