Property Summary

NCBI Gene PubMed Count 19
PubMed Score 2.21
PubTator Score 2.03

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Rheumatoid Arthritis 2.200 0.000
Waldenstrons macroglobulinemia 1.342 0.001
astrocytic glioma 1.400 0.003
oligodendroglioma 1.400 0.007
psoriasis -1.300 0.000
osteosarcoma 2.163 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
group 4 medulloblastoma 1.400 0.006
medulloblastoma, large-cell 1.700 0.000
tuberculosis 2.900 0.000
ovarian cancer -2.000 0.000
Gaucher disease type 1 -1.500 0.046

Synonym

Accession Q92609 A6NP25 C9JP52
Symbols

Gene

PANTHER Protein Class (2)

Gene RIF (3)

PMID Text
24603492 TBC1D5 and the AP2 complex are important novel regulators of the rerouting of ATG9-containing vesicular carriers toward sites of autophagosome formation.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19531583 Membrane recruitment of the cargo-selective retromer subcomplex VPS35/29/26 is catalysed by the small GTPase Rab7 and inhibited by the Rab-GAP TBC1D5.

AA Sequence

MYHSLSETRHPLQPEEQEVGIDPLSSYSNKSGGDSNKNGRRTSSTLDSEGTFNSYRKEWEELFVNNNYLA      1 - 70
TIRQKGINGQLRSSRFRSICWKLFLCVLPQDKSQWISRIEELRAWYSNIKEIHITNPRKVVGQQDLMINN     71 - 140
PLSQDEGSLWNKFFQDKELRSMIEQDVKRTFPEMQFFQQENVRKILTDVLFCYARENEQLLYKQGMHELL    141 - 210
APIVFVLHCDHQAFLHASESAQPSEEMKTVLNPEYLEHDAYAVFSQLMETAEPWFSTFEHDGQKGKETLM    211 - 280
TPIPFARPQDLGPTIAIVTKVNQIQDHLLKKHDIELYMHLNRLEIAPQIYGLRWVRLLFGREFPLQDLLV    281 - 350
VWDALFADGLSLGLVDYIFVAMLLYIRDALISSNYQTCLGLLMHYPFIGDVHSLILKALFLRDPKRNPRP    351 - 420
VTYQFHPNLDYYKARGADLMNKSRTNAKGAPLNINKVSNSLINFGRKLISPAMAPGSAGGPVPGGNSSSS    421 - 490
SSVVIPTRTSAEAPSHHLQQQQQQQRLMKSESMPVQLNKGLSSKNISSSPSVESLPGGREFTGSPPSSAT    491 - 560
KKDSFFSNISRSRSHSKTMGRKESEEELEAQISFLQGQLNDLDAMCKYCAKVMDTHLVNIQDVILQENLE    561 - 630
KEDQILVSLAGLKQIKDILKGSLRFNQSQLEAEENEQITIADNHYCSSGQGQGRGQGQSVQMSGAIKQAS    631 - 700
SETPGCTDRGNSDDFILISKDDDGSSARGSFSGQAQPLRTLRSTSGKSQAPVCSPLVFSDPLMGPASASS    701 - 770
SNPSSSPDDDSSKDSGFTIVSPLDI                                                 771 - 795
//

Text Mined References (31)

PMID Year Title
27385586 2016 Parkinson Disease-linked Vps35 R524W Mutation Impairs the Endosomal Association of Retromer and Induces ?-Synuclein Aggregation.
25056061 2014 Biological insights from 108 schizophrenia-associated genetic loci.
24603492 2014 TBC1D5 and the AP2 complex regulate ATG9 trafficking and initiation of autophagy.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23908376 2013 The LIR motif - crucial for selective autophagy.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22354992 2012 Rab GTPase-activating proteins in autophagy: regulation of endocytic and autophagy pathways by direct binding to human ATG8 modifiers.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
More...