Property Summary

NCBI Gene PubMed Count 39
PubMed Score 44.68
PubTator Score 22.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (6)

Disease Target Count P-value
lung carcinoma 2844 7.529620704177E-32
periodontitis 269 2.83472760571266E-23
non-small cell lung cancer 2798 2.82195243067256E-12
tuberculosis 1563 1.06626533577385E-8
pilocytic astrocytoma 3086 1.05170206364562E-5
invasive ductal carcinoma 2950 4.81247955785723E-5
ulcerative colitis 2087 1.13743460936503E-4
osteosarcoma 7933 5.2345411933488E-4
primary Sjogren syndrome 789 7.62020168490084E-4
interstitial cystitis 2299 0.00288713303672143
cutaneous lupus erythematosus 1056 0.00299077254821657
lung cancer 4473 0.00490212322953541
psoriasis 6685 0.0114414989995707
head and neck cancer 270 0.0237831851844926
spina bifida 1064 0.0356592388983131
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Kidney cancer 121 0.0 1.0
Disease Target Count Z-score Confidence
Orofacial cleft 38 0.0 1.0
Disease Target Count
DOCK2 deficiency 1
Disease Target Count
Immunodeficiency 40 1

Expression

  Differential Expression (15)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 0.003
psoriasis 1.300 0.011
osteosarcoma -2.724 0.001
periodontitis 1.100 0.000
tuberculosis 1.500 0.000
non-small cell lung cancer -1.474 0.000
lung cancer -1.700 0.005
interstitial cystitis 2.200 0.003
pilocytic astrocytoma 1.300 0.000
primary Sjogren syndrome 1.900 0.001
invasive ductal carcinoma 1.662 0.000
lung carcinoma -2.900 0.000
spina bifida 1.259 0.036
ulcerative colitis 2.100 0.000
head and neck cancer -1.200 0.024

Synonym

Accession Q92608 Q2M3I0 Q96AK7
Symbols IMD40

Gene

PDB

2YIN   3B13   2RQR   3A98  

  Ortholog (4)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Chicken OMA Inparanoid

Gene RIF (23)

PMID Text
26083206 Autosomal recessive DOCK2 deficiency is a new mendelian disorder with pleiotropic defects of hematopoietic and nonhematopoietic immunity.
24821968 findings reveal a previously unknown, nonredundant role for Elmo1 in controlling Dock2 levels and Dock2-dependent T cell migration in primary lymphocytes.
23986795 Interaction of HIV-1 Nef with a protein complex, which includes Rac2, DOCK2, and ELMO1, activates Rac activity in T cells
23911989 DOCK2 is required for the normal T and B cell migration and signal transduction. (Review)
23525077 DOCK2 mutations are associated with esophageal adenocarcinoma.
22844345 Interaction of HIV-1 Nef with a protein complex, which includes Rac2, DOCK2, and ELMO1, activates Rac activity in T cells
22331897 The C-terminal Pro-rich tail of ELMO1 winds around the Src-homology 3 domain of DOCK2 to form an intermolecular 5-helix bundle. The entire regions of both DOCK2 a& ELMO1 assemble to create a rigid structure required for the DOCK2 & ELMO1 binding.
21645150 Our results show CXCL13-mediated PCa cell invasion requires Akt and ERK12 activation and suggests a new role for DOCK2 in proliferation of hormone-refractory CXCR5-positive PCa cells.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20412587 prostate cancer cell lines differentially express phosphoinositide-3 kinase (PI3K) catalytic subunit isoforms and dedicator of cytokinesis 2
More...

AA Sequence

MAPWRKADKERHGVAIYNFQGSGAPQLSLQIGDVVRIQETCGDWYRGYLIKHKMLQGIFPKSFIHIKEVT      1 - 70
VEKRRNTENIIPAEIPLAQEVTTTLWEWGSIWKQLYVASKKERFLQVQSMMYDLMEWRSQLLSGTLPKDE     71 - 140
LKELKQKVTSKIDYGNKILELDLIVRDEDGNILDPDNTSVISLFHAHEEATDKITERIKEEMSKDQPDYA    141 - 210
MYSRISSSPTHSLYVFVRNFVCRIGEDAELFMSLYDPNKQTVISENYLVRWGSRGFPKEIEMLNNLKVVF    211 - 280
TDLGNKDLNRDKIYLICQIVRVGKMDLKDTGAKKCTQGLRRPFGVAVMDITDIIKGKAESDEEKQHFIPF    281 - 350
HPVTAENDFLHSLLGKVIASKGDSGGQGLWVTMKMLVGDIIQIRKDYPHLVDRTTVVARKLGFPEIIMPG    351 - 420
DVRNDIYITLLQGDFDKYNKTTQRNVEVIMCVCAEDGKTLPNAICVGAGDKPMNEYRSVVYYQVKQPRWM    421 - 490
ETVKVAVPIEDMQRIHLRFMFRHRSSLESKDKGEKNFAMSYVKLMKEDGTTLHDGFHDLVVLKGDSKKME    491 - 560
DASAYLTLPSYRHHVENKGATLSRSSSSVGGLSVSSRDVFSISTLVCSTKLTQNVGLLGLLKWRMKPQLL    561 - 630
QENLEKLKIVDGEEVVKFLQDTLDALFNIMMEHSQSDEYDILVFDALIYIIGLIADRKFQHFNTVLEAYI    631 - 700
QQHFSATLAYKKLMTVLKTYLDTSSRGEQCEPILRTLKALEYVFKFIVRSRTLFSQLYEGKEQMEFEESM    701 - 770
RRLFESINNLMKSQYKTTILLQVAALKYIPSVLHDVEMVFDAKLLSQLLYEFYTCIPPVKLQKQKVQSMN    771 - 840
EIVQSNLFKKQECRDILLPVITKELKELLEQKDDMQHQVLERKYCVELLNSILEVLSYQDAAFTYHHIQE    841 - 910
IMVQLLRTVNRTVITMGRDHILISHFVACMTAILNQMGDQHYSFYIETFQTSSELVDFLMETFIMFKDLI    911 - 980
GKNVYPGDWMAMSMVQNRVFLRAINKFAETMNQKFLEHTNFEFQLWNNYFHLAVAFITQDSLQLEQFSHA    981 - 1050
KYNKILNKYGDMRRLIGFSIRDMWYKLGQNKICFIPGMVGPILEMTLIPEAELRKATIPIFFDMMLCEYQ   1051 - 1120
RSGDFKKFENEIILKLDHEVEGGRGDEQYMQLLESILMECAAEHPTIAKSVENFVNLVKGLLEKLLDYRG   1121 - 1190
VMTDESKDNRMSCTVNLLNFYKDNNREEMYIRYLYKLRDLHLDCDNYTEAAYTLLLHTWLLKWSDEQCAS   1191 - 1260
QVMQTGQQHPQTHRQLKETLYETIIGYFDKGKMWEEAISLCKELAEQYEMEIFDYELLSQNLIQQAKFYE   1261 - 1330
SIMKILRPKPDYFAVGYYGQGFPSFLRNKVFIYRGKEYERREDFQMQLMTQFPNAEKMNTTSAPGDDVKN   1331 - 1400
APGQYIQCFTVQPVLDEHPRFKNKPVPDQIINFYKSNYVQRFHYSRPVRRGTVDPENEFASMWIERTSFV   1401 - 1470
TAYKLPGILRWFEVVHMSQTTISPLENAIETMSTANEKILMMINQYQSDETLPINPLSMLLNGIVDPAVM   1471 - 1540
GGFAKYEKAFFTEEYVRDHPEDQDKLTHLKDLIAWQIPFLGAGIKIHEKRVSDNLRPFHDRMEECFKNLK   1541 - 1610
MKVEKEYGVREMPDFDDRRVGRPRSMLRSYRQMSIISLASMNSDCSTPSKPTSESFDLELASPKTPRVEQ   1611 - 1680
EEPISPGSTLPEVKLRRSKKRTKRSSVVFADEKAAAESDLKRLSRKHEFMSDTNLSEHAAIPLKASVLSQ   1681 - 1750
MSFASQSMPTIPALALSVAGIPGLDEANTSPRLSQTFLQLSDGDKKTLTRKKVNQFFKTMLASKSAEEGK   1751 - 1820
QIPDSLSTDL                                                               1821 - 1830
//

Text Mined References (48)

PMID Year Title
26083206 2015 Inherited DOCK2 Deficiency in Patients with Early-Onset Invasive Infections.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24927181 2014 Genome-wide association study identifies three novel susceptibility loci for severe Acne vulgaris.
24821968 2014 Essential role of Elmo1 in Dock2-dependent lymphocyte migration.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23911989 2013 Immune regulatory functions of DOCK family proteins in health and disease.
23525077 2013 Exome and whole-genome sequencing of esophageal adenocarcinoma identifies recurrent driver events and mutational complexity.
23382691 2013 Loci associated with N-glycosylation of human immunoglobulin G show pleiotropy with autoimmune diseases and haematological cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...