Property Summary

NCBI Gene PubMed Count 12
PubMed Score 8.84
PubTator Score 5.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (1)

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.800 4.1e-04
medulloblastoma, large-cell -1.100 1.5e-03
lung cancer 1.400 1.6e-02
lung adenocarcinoma 1.200 2.0e-04
inflammatory breast cancer 1.100 2.0e-04
ovarian cancer 1.200 1.1e-03

Gene RIF (7)

PMID Text
25544760 Data indicate a recurrent somatic C > T change causing a P131L mutation in the RQCD1 (Required for Cell Differentiation1 Homolog) gene identified through whole exome sequencing of 20 metastatic melanomas.
24768540 Crystal structure of the DDX6, CNOT9 and CNOT1 complex.
24768538 Crystal structures of the DDX6, CNOT1 and CNOT9 complexes.
20878056 Our findings in this study imply the functional mechanism of RQCD1 in the Akt activity regulation as a mediator in the EGFR-signaling pathway
19724902 Report involvement of RQCD1 overexpression, a novel cancer-testis antigen, in the Akt pathway in breast cancer cells.
18180299 CCR4 plays a role in the regulation of certain endogenous RARalpha target genes and RCD1 and CCR4 might mediate their function through their interaction with NIF-1
12356739 mammalian protein is a novel transcriptional cofactor that mediates retinoic acid-induced cell differentiation

AA Sequence

MHSLATAAPVPTTLAQVDREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEI      1 - 70
VNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSL     71 - 140
GVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVA    141 - 210
MILGKMVLQLSKEPSARLLKHVVRCYLRLSDNPRAREALRQCLPDQLKDTTFAQVLKDDTTTKRWLAQLV    211 - 280
KNLQEGQVTDPRGIPLPPQ                                                       281 - 299
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25544760 2015 Whole exome sequencing identifies a recurrent RQCD1 P131L mutation in cutaneous melanoma.
24768540 2014 A DDX6-CNOT1 complex and W-binding pockets in CNOT9 reveal direct links between miRNA target recognition and silencing.
24768538 2014 Structural and biochemical insights to the role of the CCR4-NOT complex and DDX6 ATPase in microRNA repression.
23232451 2013 C2ORF29/CNOT11 and CNOT10 form a new module of the CCR4-NOT complex.
21269460 2011 Initial characterization of the human central proteome.
20878056 2010 Critical involvement of RQCD1 in the EGFR-Akt pathway in mammary carcinogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19724902 2009 Involvement of RQCD1 overexpression, a novel cancer-testis antigen, in the Akt pathway in breast cancer cells.
19558367 2009 Human Ccr4-Not complexes contain variable deadenylase subunits.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
18377426 2008 Interaction of antiproliferative protein Tob with the CCR4-NOT deadenylase complex.
18180299 2008 Components of the CCR4-NOT complex function as nuclear hormone receptor coactivators via association with the NRC-interacting Factor NIF-1.
17189474 2007 Atomic model of human Rcd-1 reveals an armadillo-like-repeat protein with in vitro nucleic acid binding properties.
16778766 2006 Human Ccr4-Not complex is a ligand-dependent repressor of nuclear receptor-mediated transcription.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12356739 2002 Mammalian Rcd1 is a novel transcriptional cofactor that mediates retinoic acid-induced cell differentiation.
9447985 1998 Novel factor highly conserved among eukaryotes controls sexual development in fission yeast.