Property Summary

NCBI Gene PubMed Count 12
Grant Count 18
R01 Count 15
Funding $1,858,011.11
PubMed Score 8.84
PubTator Score 5.30

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
psoriasis -1.800 0.000
medulloblastoma, large-cell -1.100 0.002
lung cancer 1.400 0.016
lung adenocarcinoma 1.200 0.000
inflammatory breast cancer 1.100 0.000
ovarian cancer 1.200 0.001

Gene RIF (7)

PMID Text
25544760 Data indicate a recurrent somatic C > T change causing a P131L mutation in the RQCD1 (Required for Cell Differentiation1 Homolog) gene identified through whole exome sequencing of 20 metastatic melanomas.
24768540 Crystal structure of the DDX6, CNOT9 and CNOT1 complex.
24768538 Crystal structures of the DDX6, CNOT1 and CNOT9 complexes.
20878056 Our findings in this study imply the functional mechanism of RQCD1 in the Akt activity regulation as a mediator in the EGFR-signaling pathway
19724902 Report involvement of RQCD1 overexpression, a novel cancer-testis antigen, in the Akt pathway in breast cancer cells.
18180299 CCR4 plays a role in the regulation of certain endogenous RARalpha target genes and RCD1 and CCR4 might mediate their function through their interaction with NIF-1
12356739 mammalian protein is a novel transcriptional cofactor that mediates retinoic acid-induced cell differentiation

AA Sequence

MHSLATAAPVPTTLAQVDREKIYQWINELSSPETRENALLELSKKRESVPDLAPMLWHSFGTIAALLQEI      1 - 70
VNIYPSINPPTLTAHQSNRVCNALALLQCVASHPETRSAFLAAHIPLFLYPFLHTVSKTRPFEYLRLTSL     71 - 140
GVIGALVKTDEQEVINFLLTTEIIPLCLRIMESGSELSKTVATFILQKILLDDTGLAYICQTYERFSHVA    141 - 210
MILGKMVLQLSKEPSARLLKHVVRCYLRLSDNPRAREALRQCLPDQLKDTTFAQVLKDDTTTKRWLAQLV    211 - 280
KNLQEGQVTDPRGIPLPPQ                                                       281 - 299
//

Text Mined References (21)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25544760 2015 Whole exome sequencing identifies a recurrent RQCD1 P131L mutation in cutaneous melanoma.
24768540 2014 A DDX6-CNOT1 complex and W-binding pockets in CNOT9 reveal direct links between miRNA target recognition and silencing.
24768538 2014 Structural and biochemical insights to the role of the CCR4-NOT complex and DDX6 ATPase in microRNA repression.
23232451 2013 C2ORF29/CNOT11 and CNOT10 form a new module of the CCR4-NOT complex.
21269460 2011 Initial characterization of the human central proteome.
20878056 2010 Critical involvement of RQCD1 in the EGFR-Akt pathway in mammary carcinogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19724902 2009 Involvement of RQCD1 overexpression, a novel cancer-testis antigen, in the Akt pathway in breast cancer cells.
19558367 2009 Human Ccr4-Not complexes contain variable deadenylase subunits.
More...