Property Summary

NCBI Gene PubMed Count 21
PubMed Score 46.96
PubTator Score 16.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Synonym

Accession Q92599 A6NC65 A6NKP6 F6W7K9 Q8IX36 Q8IX37 Q9BVB3
Symbols SEP2

Gene

Gene RIF (7)

PMID Text
20544379 Cloning, overexpression, purification and preliminary characterization of human septin 8. Fluorescence emission spectra, analytic gel filtration and DLS reflect the sample oligomeric heterogeneity with the predominance of dimers in solution.
20485362 Observational study of gene-disease association. (HuGE Navigator)
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
18187620 Knockdown of septin 8 (SEPT8) by siRNA inhibits HIV-1 replication in HeLa-derived TZM-bl cells
17625225 Our finding suggests a role for members of the septin family in the development of proliferative retinal membranes.
15214843 We studied the assembly of three human septins, SEPT4, SEPT5 and SEPT8, with each other (heterotypic) and with themselves (homotypic) using a yeast two-hybrid system.
15116257 SEPT8 and SEPT4 are localized surrounding alpha-granules. Activation of platelets by agonists resulted in the translocation of SEPT4 and SEPT8 to the platelet surface indicating a possible functional role of these proteins in platelet granular secretion

AA Sequence

MAATDLERFSNAEPEPRSLSLGGHVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTLMNTLFNTTFE      1 - 70
TEEASHHEACVRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPIVDYIDAQFENYLQEELKIRR     71 - 140
SLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSN    141 - 210
GVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREML    211 - 280
IRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVN    281 - 350
KVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQP    351 - 420
LRKDKDKKNRSDIGAHQPGMSLSSSKVMMTKASVEPLNCSSWWPAIQCCSCLVRDATWREGFL           421 - 483
//

Text Mined References (28)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20544379 2010 Cloning, overexpression, purification and preliminary characterization of human septin 8.
20485362 2010 Association analysis of susceptibility candidate region on chromosome 5q31 for tuberculosis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17685441 2007 Sept12 is a component of the mammalian sperm tail annulus.
17625225 2007 Septin expression in proliferative retinal membranes.
More...