Property Summary

NCBI Gene PubMed Count 22
PubMed Score 51.03
PubTator Score 16.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma -2.000 2.2e-06
astrocytoma 1.300 8.7e-03
Astrocytoma, Pilocytic 1.100 5.8e-06
atypical teratoid / rhabdoid tumor -1.500 3.0e-04
Breast cancer -1.200 1.4e-10
ductal carcinoma in situ -1.500 6.7e-04
ependymoma -1.200 2.9e-04
glioblastoma -2.400 1.1e-08
group 3 medulloblastoma 1.200 6.8e-03
interstitial cystitis -1.100 5.0e-05
invasive ductal carcinoma -2.000 2.0e-03
lung adenocarcinoma -1.200 1.4e-15
lung cancer 1.200 3.4e-02
malignant mesothelioma -1.100 9.6e-06
medulloblastoma, large-cell -1.400 6.1e-03
non-small cell lung cancer -2.368 2.3e-35
oligodendroglioma 1.300 2.7e-02
osteosarcoma -1.075 4.3e-03
ovarian cancer 2.000 4.4e-05
pancreatic cancer 1.200 2.2e-02
Pick disease -1.200 3.7e-04
primary pancreatic ductal adenocarcinoma 1.252 9.3e-03
primitive neuroectodermal tumor -1.300 1.5e-02
progressive supranuclear palsy -1.200 1.9e-02
psoriasis 1.600 6.7e-05
subependymal giant cell astrocytoma -2.084 1.3e-02

Gene RIF (8)

AA Sequence

MAATDLERFSNAEPEPRSLSLGGHVGFDSLPDQLVSKSVTQGFSFNILCVGETGIGKSTLMNTLFNTTFE      1 - 70
TEEASHHEACVRLRPQTYDLQESNVQLKLTIVDAVGFGDQINKDESYRPIVDYIDAQFENYLQEELKIRR     71 - 140
SLFDYHDTRIHVCLYFITPTGHSLKSLDLVTMKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSN    141 - 210
GVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREML    211 - 280
IRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVN    281 - 350
KVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQP    351 - 420
LRKDKDKKNRSDIGAHQPGMSLSSSKVMMTKASVEPLNCSSWWPAIQCCSCLVRDATWREGFL           421 - 483
//

Text Mined References (29)

PMID Year Title