Property Summary

NCBI Gene PubMed Count 164
Grant Count 23
R01 Count 8
Funding $5,755,649.22
PubMed Score 241.94
PubTator Score 270.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Gene RIF (134)

PMID Text
26895766 Data suggest that, in colonic/prostatic neoplasm cells, increased expression of NDRG1 decreases activating phosphorylation of FAK and paxillin; silencing/inhibition of NDRG1 results in opposite effect and inhibits neoplasm cell migration/adhesion.
26653549 NDRG1 could increase the resistance of neuroblastoma cells to chemotherapeutic drugs, with its positive regulation on drug resistant proteins.
26534963 Data suggest that NDRG1 down-regulates expression and activation of HER1/EGFR, HER2/ERBB2, and HER3/ERBB3 in response to epidermal growth factor (EGF) ligand in pancreatic/colonic neoplasm cells.
26418878 NDRG1 inhibits stemness of colorectal cancer via down-regulation of nuclear beta-catenin and CD44
26359353 Data indicate that N-myc downstream regulated gene 1 (NDRG1) competitively bind to glycogen synthase kinase 3beta (GSK-3beta) and orphan nuclear receptor (Nur77) to prevent beta-catenin degradation.
26349604 GLI1 expression in both H441 and PW cells was associated with increased expression of NDRG1, a gene known to be downregulated by the MYC family of proteins, indicating that upregulation of NDRG1 by GLI1 is not cell-type specific.
26324937 TP53 loss leads to abnormal centrosome numbers and genomic instability mediated by NDRG1
26202882 Results show that aberrant methylation of NDRG1 promoter is an important mechanism for gene silencing, playing a major role in tumor occurrence and progression of protate cancer (Pca). Reversing this process may be used for PCa treatment.
26028238 pomegranate juice-mediated decrease in cell death in hypoxia is partially mediated by NDRG1 in BeWo cells but not in primary trophoblasts.
25860930 NDRG1 decreases phosphorylation of c-Src at Tyr416 by down-regulating EGFR expression and activation. It also affected Rac1, p130Cas, CrkII, and c-Abl. NDRG1 decreases cell migration via c-src inhibition.
More...

AA Sequence

MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHK      1 - 70
TCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTG     71 - 140
AGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHT    141 - 210
YRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTK    211 - 280
TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGT    281 - 350
RSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC                              351 - 394
//

Text Mined References (172)

PMID Year Title
26895766 2016 Targeting the Metastasis Suppressor, N-Myc Downstream Regulated Gene-1, with Novel Di-2-Pyridylketone Thiosemicarbazones: Suppression of Tumor Cell Migration and Cell-Collagen Adhesion by Inhibiting Focal Adhesion Kinase/Paxillin Signaling.
26653549 2015 NDRG1 promotes the multidrug resistance of neuroblastoma cells with upregulated expression of drug resistant proteins.
26534963 2016 The Metastasis Suppressor, N-MYC Downstream-regulated Gene-1 (NDRG1), Down-regulates the ErbB Family of Receptors to Inhibit Downstream Oncogenic Signaling Pathways.
26418878 2015 The metastasis suppressor, NDRG1, inhibits "stemness" of colorectal cancer via down-regulation of nuclear ?-catenin and CD44.
26359353 2015 NDRG1 promotes growth of hepatocellular carcinoma cells by directly interacting with GSK-3? and Nur77 to prevent ?-catenin degradation.
26349604 2015 Role of GLI1 and NDRG1 in Increased Resistance to Apoptosis Induction.
26324937 2015 NDRG1 links p53 with proliferation-mediated centrosome homeostasis and genome stability.
26202882 2015 Downregulation of N-myc downstream regulated gene 1 caused by the methylation of CpG islands of NDRG1 promoter promotes proliferation and invasion of prostate cancer cells.
26028238 2015 N-myc downstream-regulated gene 1 (NDRG1) mediates pomegranate juice protection from apoptosis in hypoxic BeWo cells but not in primary human trophoblasts.
25860930 2015 The proto-oncogene c-Src and its downstream signaling pathways are inhibited by the metastasis suppressor, NDRG1.
More...