Property Summary

NCBI Gene PubMed Count 181
PubMed Score 245.75
PubTator Score 270.15

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 4.466 2.2

Expression

  Differential Expression (16)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -2.000 1.1e-05
Breast cancer 1.400 8.3e-04
breast carcinoma -1.300 4.0e-05
colon cancer -1.500 2.6e-02
fibroadenoma -1.300 2.3e-03
group 3 medulloblastoma -1.400 9.7e-03
intraductal papillary-mucinous carcinoma... 1.100 5.1e-03
lung cancer -1.100 2.9e-04
medulloblastoma, large-cell -1.900 1.8e-03
non-small cell lung cancer 1.095 5.3e-09
ovarian cancer 1.200 5.8e-03
primary pancreatic ductal adenocarcinoma 1.120 2.3e-02
primitive neuroectodermal tumor -1.600 2.3e-03
subependymal giant cell astrocytoma -2.200 1.5e-02
tuberculosis -1.200 8.0e-06
ulcerative colitis -1.100 5.0e-06

Gene RIF (151)

AA Sequence

MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCGTPKGNRPVILTYHDIGMNHK      1 - 70
TCYNPLFNYEDMQEITQHFAVCHVDAPGQQDGAASFPAGYMYPSMDQLAEMLPGVLQQFGLKSIIGMGTG     71 - 140
AGAYILTRFALNNPEMVEGLVLINVNPCAEGWMDWAASKISGWTQALPDMVVSHLFGKEEMQSNVEVVHT    141 - 210
YRQHIVNDMNPGNLHLFINAYNSRRDLEIERPMPGTHTVTLQCPALLVVGDSSPAVDAVVECNSKLDPTK    211 - 280
TTLLKMADCGGLPQISQPAKLAEAFKYFVQGMGYMPSASMTRLMRSRTASGSSVTSLDGTRSRSHTSEGT    281 - 350
RSRSHTSEGTRSRSHTSEGAHLDITPNSGAAGNSAGPKSMEVSC                              351 - 394
//

Text Mined References (189)

PMID Year Title