Property Summary

NCBI Gene PubMed Count 46
PubMed Score 41.27
PubTator Score 35.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.100 4.8e-02
Alzheimer's disease 1.300 1.5e-02
astrocytic glioma 1.200 4.1e-03
glioblastoma -1.500 6.8e-04
invasive ductal carcinoma -1.300 1.7e-03
lung cancer -1.200 1.9e-02
medulloblastoma, large-cell -1.100 4.8e-02
oligodendroglioma 1.500 3.9e-03
ovarian cancer -1.200 5.1e-11
Pick disease 1.400 9.6e-06
posterior fossa group A ependymoma -1.100 8.0e-04
progressive supranuclear palsy 1.300 8.5e-03
psoriasis 1.200 3.5e-06
sonic hedgehog group medulloblastoma 1.200 1.3e-04

Protein-protein Interaction (4)

Gene RIF (32)

AA Sequence

MVLPTCPMAEFALPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALHQRCIQAKAKR      1 - 70
AGKHRQPPAATAPAPAAPAPRLDAADGPEHGRPATHLHDTVKRNLDSATSPQNGDQQNGYGDLFPGHKKT     71 - 140
RREAPLGVAISSNGLPPASPLGQSDKPSGADALQSSGKHSLGLDSLNKKRLADSSLHLNGGSNPSESFPL    141 - 210
SLNKELKQEPVEDLPCMITGTVGSISQSNLMPDLNLNEQEWKELIEELNRSVPDEDMKDLFNEDFEEKKD    211 - 280
PESSGSATQTPLAQDINIKTEFSPAAFEQEQLGSPQVRAGSAGQTFLGPSSAPVSTDSPSLGGSQTLFHT    281 - 350
SGQPRADNPSPNLMPASAQAQNAQRALAGVVLPSQGPGGASELSSAHQLQQIAAKQKREQMLQNPQQATP    351 - 420
APAPGQMSTWQQTGPSHSSLDVPYPMEKPASPSSYKQDFTNSKLLMMPSVNKSSPRPGGPYLQPSHVNLL    421 - 490
SHQPPSNLNQNSANNQGSVLDYGNTKPLSHYKADCGQGSPGSGQSKPALMAYLPQQLSHISHEQNSLFLM    491 - 560
KPKPGNMPFRSLVPPGQEQNPSSVPVQAQATSVGTQPPAVSVASSHNSSPYLSSQQQAAVMKQHQLLLDQ    561 - 630
QKQREQQQKHLQQQQFLQRQQHLLAEQEKQQFQRHLTRPPPQYQDPTQGSFPQQVGQFTGSSAAVPGMNT    631 - 700
LGPSNSSCPRVFPQAGNLMPMGPGHASVSSLPTNSGQQDRGVAQFPGSQNMPQSSLYGMASGITQIVAQP    701 - 770
PPQATNGHAHIPRQTNVGQNTSVSAAYGQNSLGSSGLSQQHNKGTLNPGLTKPPVPRVSPAMGGQNSSWQ    771 - 840
HQGMPNLSGQTPGNSNVSPFTAASSFHMQQQAHLKMSSPQFSQAVPNRPMAPMSSAAAVGSLLPPVSAQQ    841 - 910
RTSAPAPAPPPTAPQQGLPGLSPAGPELGAFSQSPASQMGGRAGLHCTQAYPVRTAGQELPFAYSGQPGG    911 - 980
SGLSSVAGHTDLIDSLLKNRTSEEWMSDLDDLLGSQ                                      981 - 1016
//

Text Mined References (49)

PMID Year Title