Property Summary

NCBI Gene PubMed Count 39
Grant Count 41
R01 Count 29
Funding $2,453,829.65
PubMed Score 37.73
PubTator Score 35.11

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytic glioma 1.200 0.004
oligodendroglioma 1.500 0.004
glioblastoma -1.500 0.001
medulloblastoma, large-cell -1.100 0.048
lung cancer -1.200 0.019
pediatric high grade glioma -1.200 0.004
posterior fossa group A ependymoma -1.100 0.001
sonic hedgehog group medulloblastoma 1.200 0.000
psoriasis 1.200 0.000
Alzheimer's disease 1.300 0.015
Pick disease 1.400 0.000
progressive supranuclear palsy 1.300 0.009
invasive ductal carcinoma -1.300 0.002
ovarian cancer -1.200 0.000

 GWAS Trait (1)

Gene RIF (29)

PMID Text
26857655 The transcriptional coregulator MAML1 affects DNA methylation and gene expression patterns in human embryonic kidney cells.
26662507 Notch signaling was altered in almost half of the clear-cell renal cell carcinoma patients and copy number variances in MAML1 and KAT2B were predominant changes.
26294058 MMAL1 overexpression is associated with Esophageal Squamous Cell Carcinoma.
26225565 study identifies that MAML1 is ubiquitinated in the absence of Notch signaling to maintain low levels of MAML1 in the cell
26033683 In MCF-7 cells p53 associates with the Notch transcriptional complex (NTC) in a MAML1-dependent fashion, most likely through a p53-MAML1 interaction.
24680774 The impact of MAML1 genetic variants to heart rate was discovered.
23454378 Snail decreased transcription of Notch1 intracellular domain (NICD) target genes via competing with MAML1, co-activator, in NICD complex.
23365452 Authors report that human papillomavirus type 8 E6 subverts NOTCH activation during keratinocyte differentiation by inhibiting RBPJ/MAML1 transcriptional activator complexes at NOTCH target DNA.
23029358 Bioinformatics assessment revealed a correlation between p300, EGR1 and MAML1 copy number and mRNA alterations in renal clear cell carcinoma and p300, EGR1 and MAML1 gene alterations were associated with increased overall survival.
22990361 Data indicate that EpCAM, CK19, and hMAM triple-marker-positive circulating tumor cells (CTCs) were detected in 86 of 98 (87.8 %) patients.
More...

AA Sequence

MVLPTCPMAEFALPRHSAVMERLRRRIELCRRHHSTCEARYEAVSPERLELERQHTFALHQRCIQAKAKR      1 - 70
AGKHRQPPAATAPAPAAPAPRLDAADGPEHGRPATHLHDTVKRNLDSATSPQNGDQQNGYGDLFPGHKKT     71 - 140
RREAPLGVAISSNGLPPASPLGQSDKPSGADALQSSGKHSLGLDSLNKKRLADSSLHLNGGSNPSESFPL    141 - 210
SLNKELKQEPVEDLPCMITGTVGSISQSNLMPDLNLNEQEWKELIEELNRSVPDEDMKDLFNEDFEEKKD    211 - 280
PESSGSATQTPLAQDINIKTEFSPAAFEQEQLGSPQVRAGSAGQTFLGPSSAPVSTDSPSLGGSQTLFHT    281 - 350
SGQPRADNPSPNLMPASAQAQNAQRALAGVVLPSQGPGGASELSSAHQLQQIAAKQKREQMLQNPQQATP    351 - 420
APAPGQMSTWQQTGPSHSSLDVPYPMEKPASPSSYKQDFTNSKLLMMPSVNKSSPRPGGPYLQPSHVNLL    421 - 490
SHQPPSNLNQNSANNQGSVLDYGNTKPLSHYKADCGQGSPGSGQSKPALMAYLPQQLSHISHEQNSLFLM    491 - 560
KPKPGNMPFRSLVPPGQEQNPSSVPVQAQATSVGTQPPAVSVASSHNSSPYLSSQQQAAVMKQHQLLLDQ    561 - 630
QKQREQQQKHLQQQQFLQRQQHLLAEQEKQQFQRHLTRPPPQYQDPTQGSFPQQVGQFTGSSAAVPGMNT    631 - 700
LGPSNSSCPRVFPQAGNLMPMGPGHASVSSLPTNSGQQDRGVAQFPGSQNMPQSSLYGMASGITQIVAQP    701 - 770
PPQATNGHAHIPRQTNVGQNTSVSAAYGQNSLGSSGLSQQHNKGTLNPGLTKPPVPRVSPAMGGQNSSWQ    771 - 840
HQGMPNLSGQTPGNSNVSPFTAASSFHMQQQAHLKMSSPQFSQAVPNRPMAPMSSAAAVGSLLPPVSAQQ    841 - 910
RTSAPAPAPPPTAPQQGLPGLSPAGPELGAFSQSPASQMGGRAGLHCTQAYPVRTAGQELPFAYSGQPGG    911 - 980
SGLSSVAGHTDLIDSLLKNRTSEEWMSDLDDLLGSQ                                      981 - 1016
//

Text Mined References (42)

PMID Year Title
26857655 2016 The transcriptional coregulator MAML1 affects DNA methylation and gene expression patterns in human embryonic kidney cells.
26662507 Genetic alteration in notch pathway is associated with better prognosis in renal cell carcinoma.
26294058 2015 Role of Msi1 and MAML1 in Regulation of Notch Signaling Pathway in Patients with Esophageal Squamous Cell Carcinoma.
26225565 2015 Mastermind-Like 1 Is Ubiquitinated: Functional Consequences for Notch Signaling.
26033683 2015 p53 Modulates Notch Signaling in MCF-7 Breast Cancer Cells by Associating With the Notch Transcriptional Complex Via MAML1.
24680774 2014 Insight into genetic determinants of resting heart rate.
23454378 2013 Snail inhibits Notch1 intracellular domain mediated transcriptional activation via competing with MAML1.
23365452 2013 The human papillomavirus type 8 E6 protein interferes with NOTCH activation during keratinocyte differentiation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23029358 2012 MAML1 acts cooperatively with EGR1 to activate EGR1-regulated promoters: implications for nephrogenesis and the development of renal cancer.
More...