Property Summary

NCBI Gene PubMed Count 15
Grant Count 5
R01 Count 5
Funding $610,403.5
PubMed Score 2.31
PubTator Score 2.62

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (23)

Synonym

Accession Q92575 A8K9W4 Q4ZG56 Q8IYM5
Symbols UBXD2
UBXDC1
erasin

Gene

PDB

2KXJ  

Gene RIF (2)

PMID Text
19822669 Knockdown of erasin, a platform for p97/VCP and ubiquilin binding, or knockdown of ubiquilin in human cells slowed degradation of two classical endoplasmic reticulum-associated protein degradation substrates.
16968747 Erasin/UBXD2 may be involved in endoplasmic-reticulum-associated protein degradation and in Alzheimer's disease.

AA Sequence

MLWFQGAIPAAIATAKRSGAVFVVFVAGDDEQSTQMAASWEDDKVTEASSNSFVAIKIDTKSEACLQFSQ      1 - 70
IYPVVCVPSSFFIGDSGIPLEVIAGSVSADELVTRIHKVRQMHLLKSETSVANGSQSESSVSTPSASFEP     71 - 140
NNTCENSQSRNAELCEIPPTSDTKSDTATGGESAGHATSSQEPSGCSDQRPAEDLNIRVERLTKKLEERR    141 - 210
EEKRKEEEQREIKKEIERRKTGKEMLDYKRKQEEELTKRMLEERNREKAEDRAARERIKQQIALDRAERA    211 - 280
ARFAKTKEEVEAAKAAALLAKQAEMEVKRESYARERSTVARIQFRLPDGSSFTNQFPSDAPLEEARQFAA    281 - 350
QTVGNTYGNFSLATMFPRREFTKEDYKKKLLDLELAPSASVVLLPAGRPTASIVHSSSGDIWTLLGTVLY    351 - 420
PFLAIWRLISNFLFSNPPPTQTSVRVTSSEPPNPASSSKSEKREPVRKRVLEKRGDDFKKEGKIYRLRTQ    421 - 490
DDGEDENNTWNGNSTQQM                                                        491 - 508
//

Text Mined References (22)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21979947 2012 A genome-wide association study identifies a potential novel gene locus for keratoconus, one of the commonest causes for corneal transplantation in developed countries.
21269460 2011 Initial characterization of the human central proteome.
19822669 2009 Ubiquilin and p97/VCP bind erasin, forming a complex involved in ERAD.
18775313 2008 UBXD7 binds multiple ubiquitin ligases and implicates p97 in HIF1alpha turnover.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
More...