Property Summary

NCBI Gene PubMed Count 65
Grant Count 111
R01 Count 53
Funding $30,197,118.14
PubMed Score 106.27
PubTator Score 205.67

Knowledge Summary

Patent (152,037)

Expression

  Differential Expression (20)

Disease log2 FC p
gastric cancer -1.100 0.031
cutaneous lupus erythematosus 2.100 0.006
osteosarcoma 1.106 0.037
glioblastoma -1.200 0.006
sonic hedgehog group medulloblastoma -1.800 0.032
adrenocortical carcinoma -2.426 0.000
tuberculosis -4.000 0.000
non-small cell lung cancer -2.287 0.000
intraductal papillary-mucinous carcinoma... -1.400 0.045
intraductal papillary-mucinous neoplasm ... -1.300 0.034
lung cancer -5.700 0.000
interstitial cystitis 1.500 0.002
pediatric high grade glioma -1.200 0.029
lung adenocarcinoma -1.888 0.000
Breast cancer -2.300 0.000
ulcerative colitis 1.500 0.001
Gaucher disease type 3 -2.000 0.012
pituitary cancer -2.000 0.001
chronic rhinosinusitis -2.085 0.009
psoriasis 2.300 0.000

Synonym

Accession Q92570 A2A3I7 Q12935 Q14979 Q16420 Q4VXA8 Q4VXA9 Q9UEK2 Q9UEK3
Symbols CHN
TEC
CSMF
NOR1
MINOR

Gene

  TechDev Info (2)

Jing-Ruey Yeh gRNA validated for zebrafish model, zebrafish mutant available, zebrafish phenotype observed
Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

Gene RIF (54)

PMID Text
26634653 Identified Nur77/Nor1 as novel regulators of thrombomodulin expression and function in vascular endothelial cells.
26600038 miR-17 and -20a target NOR-1 thereby regulating NOR-1-dependent gene expression.
25941992 Data identify NOR1 as a transcription factor induced during alternative differentiation of human macrophages and demonstrate that NOR1 modifies the alternative macrophage phenotype.
25917081 NR4A2 is a key factor in multiple diseases, such as inflammation, cancer and cardiovascular diseases.
25852083 DNA-PK directly phosphorylates NOR-1, modulating vascular smooth muscle cell proliferation.
25844690 NOR1 promotes the proliferation of pulmonary artery smooth muscle cells.
25809189 A2M is expressed in the vasculature and NR4A receptors modulate VSMC MMP2/9 activity by several mechanisms including the up-regulation of A2M.
25536180 Our data support a role for NOR-1 as a negative modulator of the acute response elicited by pro-inflammatory stimuli in the vasculature.
25449536 identified 13 ADCC-activated genes. Six gene expression assays including 8 of the 13 genes (CCL3, CCL4/CCL4L1/CCL4L2, CD160, IFNG, NR4A3 and XCL1/XCL2) were analyzed in 127 kidney biopsies
25410408 The authors discuss the role of NR4A1 and NR4A3 as tumor suppressors in hematologic neoplasms.[Review]
More...

AA Sequence

MPCVQAQYSPSPPGSSYAAQTYSSEYTTEIMNPDYTKLTMDLGSTEITATATTSLPSISTFVEGYSSNYE      1 - 70
LKPSCVYQMQRPLIKVEEGRAPSYHHHHHHHHHHHHHHQQQHQQPSIPPASSPEDEVLPSTSMYFKQSPP     71 - 140
STPTTPAFPPQAGALWDEALPSAPGCIAPGPLLDPPMKAVPTVAGARFPLFHFKPSPPHPPAPSPAGGHH    141 - 210
LGYDPTAAAALSLPLGAAAAAGSQAAALESHPYGLPLAKRAAPLAFPPLGLTPSPTASSLLGESPSLPSP    211 - 280
PSRSSSSGEGTCAVCGDNAACQHYGVRTCEGCKGFFKRTVQKNAKYVCLANKNCPVDKRRRNRCQYCRFQ    281 - 350
KCLSVGMVKEVVRTDSLKGRRGRLPSKPKSPLQQEPSQPSPPSPPICMMNALVRALTDSTPRDLDYSRYC    351 - 420
PTDQAAAGTDAEHVQQFYNLLTASIDVSRSWAEKIPGFTDLPKEDQTLLIESAFLELFVLRLSIRSNTAE    421 - 490
DKFVFCNGLVLHRLQCLRGFGEWLDSIKDFSLNLQSLNLDIQALACLSALSMITERHGLKEPKRVEELCN    491 - 560
KITSSLKDHQSKGQALEPTESKVLGALVELRKICTLGLQRIFYLKLEDLVSPPSIIDKLFLDTLPF        561 - 626
//

Text Mined References (65)

PMID Year Title
26634653 2016 Antithrombotic Effects of Nur77 and Nor1 Are Mediated Through Upregulating Thrombomodulin Expression in Endothelial Cells.
26600038 2015 miR-17 and -20a Target the Neuron-Derived Orphan Receptor-1 (NOR-1) in Vascular Endothelial Cells.
25941992 2015 The neuron-derived orphan receptor 1 (NOR1) is induced upon human alternative macrophage polarization and stimulates the expression of markers of the M2 phenotype.
25917081 2016 Nuclear receptor 4A (NR4A) family - orphans no more.
25852083 2015 DNA-dependent protein kinase (DNA-PK) permits vascular smooth muscle cell proliferation through phosphorylation of the orphan nuclear receptor NOR1.
25844690 2015 Neuron-derived orphan receptor 1 promoted human pulmonary artery smooth muscle cells proliferation.
25809189 2015 NR4A receptors up-regulate the antiproteinase alpha-2 macroglobulin (A2M) and modulate MMP-2 and MMP-9 in vascular smooth muscle cells.
25536180 2015 NOR-1 modulates the inflammatory response of vascular smooth muscle cells by preventing NF?B activation.
25449536 2015 Genes associated with antibody-dependent cell activation are overexpressed in renal biopsies from patients with antibody-mediated rejection.
25410408 2015 The nuclear orphan receptor NR4A1 and NR4A3 as tumor suppressors in hematologic neoplasms.
More...