Property Summary

NCBI Gene PubMed Count 45
Grant Count 13
R01 Count 7
Funding $797,689.42
PubMed Score 32.30
PubTator Score 41.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
nephrosclerosis 1.065 0.002
malignant mesothelioma -1.300 0.000
juvenile dermatomyositis 1.046 0.000
intraductal papillary-mucinous adenoma (... -1.400 0.013
lung cancer -1.400 0.002
active Crohn's disease 2.388 0.001
active ulcerative colitis 2.246 0.005
psoriasis -1.200 0.000
Breast cancer 1.300 0.000
invasive ductal carcinoma 1.100 0.039
ovarian cancer 2.300 0.000

Gene RIF (20)

PMID Text
26826873 The proliferation, migration and invasion was decreased in ovarian SKOV3 when HOTAIR or PIK3R3 was silenced.
26252738 PIK3R3 was identified as a crucial target gene of miR-132.
25608840 our findings provide new insights into tumor suppression by miR-511 by negatively regulating the PIK3R3/AKT/mTOR signaling pathway
25388664 p55gamma sequentially up-regulated p53 and p21, resulting in cell-cycle arrest in S phase; small-interfering RNA knockdown of either p53 or p21 blocked p55gamma-induced vascular smooth muscle cell growth arrest.
25371235 TGF-beta/NKX2.1/PIK3R3 axis is crucial in the TGF-beta-induced inhibition of cell proliferation, and the NKX2.1/PIK3R3 axis might become a target in TGF-beta receptor-repressed lung adenocarcinoma
24982892 PIK3R3, ITGB1, ITGAL, and ITGA6, were involved in the regulation of actin cytoskeleton that link to triple-negative breast cancer migration.
24837077 Overexpression of PIK3R3 depends on SNAI2, inducing significant epithelial-to-mesenchymal transition (EMT).
24632606 study shows that the p53/miR-148b/p55PIK axis has an important role in cell proliferation and tumor growth, and may represent a novel therapeutic target for treating cancers containing p53 mutations or losses.
24469061 discovered that ERBB4 and S6K2 were the direct targets of miR-193a-3p and that PIK3R3 and mTOR were the direct targets of miR-193a-5p in non-small-cell lung cancer
24130211 p55PIK could be a substrate of activated caspase 6 during paraquat-induced apoptosis, leading to loss of original biological functions and redistribution to disturb cell cycle progression.
More...

AA Sequence

MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVPNGMKDSSVSLQDAEWYWGDI      1 - 70
SREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHY     71 - 140
HHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQ    141 - 210
MKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQD    211 - 280
LKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENL    281 - 350
PHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN    351 - 420
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR                                 421 - 461
//

Text Mined References (47)

PMID Year Title
26826873 2016 HOTAIR Promotes Proliferation, Migration, and Invasion of Ovarian Cancer SKOV3 Cells Through Regulating PIK3R3.
26820128 2016 miR-152 functions as a tumor suppressor in colorectal cancer by targeting PIK3R3.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26252738 2015 MiR-132 inhibits cell proliferation, invasion and migration of hepatocellular carcinoma by targeting PIK3R3.
25814554 2015 Phospho-tyrosine dependent protein-protein interaction network.
25608840 2015 MiR-511 inhibits growth and metastasis of human hepatocellular carcinoma cells by targeting PIK3R3.
25388664 2015 Identification of PI3K regulatory subunit p55? as a novel inhibitor of vascular smooth muscle cell proliferation and neointimal formation.
25371235 2015 TGF-? regulates the proliferation of lung adenocarcinoma cells by inhibiting PIK3R3 expression.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24982892 2014 Computational analysis of mRNA expression profiles identifies the ITG family and PIK3R3 as crucial genes for regulating triple negative breast cancer cell migration.
More...