Property Summary

NCBI Gene PubMed Count 49
PubMed Score 38.20
PubTator Score 41.24

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
active Crohn's disease 2.388 7.7e-04
active ulcerative colitis 2.246 4.6e-03
Breast cancer 1.300 1.6e-10
intraductal papillary-mucinous adenoma (... -1.400 1.3e-02
invasive ductal carcinoma 1.100 3.9e-02
juvenile dermatomyositis 1.046 6.8e-10
lung cancer -1.400 2.5e-03
malignant mesothelioma -1.300 1.0e-06
nephrosclerosis 1.065 1.7e-03
ovarian cancer 2.300 6.1e-05
psoriasis -1.200 1.8e-06

Protein-protein Interaction (7)

Gene RIF (24)

AA Sequence

MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVPNGMKDSSVSLQDAEWYWGDI      1 - 70
SREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDGKYGFSDPLTFNSVVELINHY     71 - 140
HHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKKLQEYHSQYQEKSKEYDRLYEEYTRTSQEIQ    141 - 210
MKRTAIEAFNETIKIFEEQCHTQEQHSKEYIERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQD    211 - 280
LKNQALDNREIDKKMNSIKPDLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENL    281 - 350
PHYDEKTWFVEDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN    351 - 420
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR                                 421 - 461
//

Text Mined References (51)

PMID Year Title