Property Summary

NCBI Gene PubMed Count 13
PubMed Score 7.13
PubTator Score 10.57

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
Rheumatoid Arthritis 1.400 0.001
psoriasis -1.300 0.002
osteosarcoma 1.023 0.006
atypical teratoid / rhabdoid tumor -1.600 0.000
medulloblastoma -1.300 0.000
medulloblastoma, large-cell -2.300 0.000
ovarian cancer 1.700 0.000

Gene RIF (4)

PMID Text
25260657 Data show that tongue cancer resistance-associated protein 1 (TCRP1) contributes to cisplatin (DDP) resistance via the increased expression of DNA polymerase beta subunit (Pol beta) in lung cancer cells.
23251525 siRNA-mediated knockdown of TCRP1 and MT1X was found to sensitize cells to cisplatin, leading to increased apoptosis and inhibition of cell proliferation
21603883 these results provided strong evidence for the linkage between TCRP1 and radiation sensitivity and may provide theoretical base of TCRP1 as a potential molecular mark of estimating the response for irradiation in oral squamous cell carcinoma.
21334329 Data suggest that TCRP1 (EF363480) might be a novel molecular target to develop agents to reverse cisplatin-induced chemoresistance.

AA Sequence

MNPVYSPVQPGAPYGNPKNMAYTGYPTAYPAAAPAYNPSLYPTNSPSYAPEFQFLHSAYATLLMKQAWPQ      1 - 70
NSSSCGTEGTFHLPVDTGTENRTYQASSAAFRYTAGTPYKVPPTQSNTAPPPYSPSPNPYQTAMYPIRSA     71 - 140
YPQQNLYAQGAYYTQPVYAAQPHVIHHTTVVQPNSIPSAIYPAPVAAPRTNGVAMGMVAGTTMAMSAGTL    141 - 210
LTTPQHTAIGAHPVSMPTYRAQGTPAYSYVPPHW                                        211 - 244
//

Text Mined References (16)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25260657 2015 TCRP1 contributes to cisplatin resistance by preventing Pol ? degradation in lung cancer cells.
23284291 2012 Genome-wide joint meta-analysis of SNP and SNP-by-smoking interaction identifies novel loci for pulmonary function.
23251525 2012 Microarray-assisted pathway analysis identifies MT1X & NF?B as mediators of TCRP1-associated resistance to cisplatin in oral squamous cell carcinoma.
22771904 2012 Characterizing the neurite outgrowth inhibitory effect of Mani.
22365988 2012 Purification and biochemical characterization of a novel protein-tongue cancer chemotherapy resistance-associated protein1 (TCRP1).
21603883 2011 TCRP1 promotes radioresistance of oral squamous cell carcinoma cells via Akt signal pathway.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21334329 2011 Cloning and functional characterization of TCRP1, a novel gene mediating resistance to cisplatin in an oral squamous cell carcinoma cell line.
19413330 2009 Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach.
More...