Property Summary

NCBI Gene PubMed Count 14
PubMed Score 10.63
PubTator Score 10.57

Knowledge Summary


No data available


  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.600 1.1e-04
medulloblastoma -1.300 4.7e-04
medulloblastoma, large-cell -1.300 2.4e-05
osteosarcoma 1.023 6.2e-03
ovarian cancer 1.100 1.3e-05
psoriasis -1.100 9.6e-10
Rheumatoid arthritis 1.400 1.2e-03


Accession Q92567 A2ICY2 A2ID81 Q86UG2
Symbols TCRP1


  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (4)

AA Sequence

LTTPQHTAIGAHPVSMPTYRAQGTPAYSYVPPHW                                        211 - 244

Text Mined References (17)

PMID Year Title